BLASTX nr result
ID: Jatropha_contig00044013
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00044013 (353 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520299.1| UDP-n-acteylglucosamine pyrophosphorylase, p... 59 8e-07 ref|XP_002302216.1| predicted protein [Populus trichocarpa] gi|2... 57 3e-06 >ref|XP_002520299.1| UDP-n-acteylglucosamine pyrophosphorylase, putative [Ricinus communis] gi|223540518|gb|EEF42085.1| UDP-n-acteylglucosamine pyrophosphorylase, putative [Ricinus communis] Length = 622 Score = 58.5 bits (140), Expect = 8e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +2 Query: 2 PEEIRIRGFRIKKIEQLEKHYSEPGKFDLKA 94 PEEIR RGFRIKKIEQLEKHY EPG+FD KA Sbjct: 592 PEEIRTRGFRIKKIEQLEKHYCEPGQFDPKA 622 >ref|XP_002302216.1| predicted protein [Populus trichocarpa] gi|222843942|gb|EEE81489.1| hypothetical protein POPTR_0002s07790g [Populus trichocarpa] Length = 522 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 2 PEEIRIRGFRIKKIEQLEKHYSEPGKFDLKA 94 PE IRIRGFR KKIEQLEK +SEPGKF+LKA Sbjct: 492 PEAIRIRGFRFKKIEQLEKQFSEPGKFELKA 522