BLASTX nr result
ID: Jatropha_contig00043598
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00043598 (496 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001119115.1| conserved peptide upstream open reading fram... 77 3e-12 ref|XP_006362036.1| PREDICTED: uncharacterized protein LOC102590... 76 5e-12 ref|XP_004507476.1| PREDICTED: uncharacterized protein LOC101515... 74 1e-11 ref|XP_004289641.1| PREDICTED: uncharacterized protein LOC101313... 73 3e-11 ref|XP_004500792.1| PREDICTED: uncharacterized protein LOC101488... 73 4e-11 ref|XP_004248699.1| PREDICTED: uncharacterized protein LOC101260... 71 2e-10 gb|ESW03793.1| hypothetical protein PHAVU_011G042700g [Phaseolus... 70 2e-10 ref|XP_003544337.1| PREDICTED: uncharacterized protein LOC100799... 69 6e-10 gb|EOY14848.1| Peptide upstream open reading frame 5 [Theobroma ... 68 1e-09 ref|XP_004500982.1| PREDICTED: uncharacterized protein LOC101493... 67 3e-09 ref|XP_006340664.1| PREDICTED: uncharacterized protein LOC102593... 65 7e-09 ref|XP_002887590.1| expressed protein [Arabidopsis lyrata subsp.... 65 1e-08 gb|ESW31431.1| hypothetical protein PHAVU_002G237700g [Phaseolus... 64 1e-08 ref|XP_004499194.1| PREDICTED: uncharacterized protein LOC101496... 64 1e-08 ref|XP_004504309.1| PREDICTED: uncharacterized protein LOC101502... 64 2e-08 ref|XP_004973272.1| PREDICTED: basic leucine zipper 9-like isofo... 63 4e-08 ref|NP_001117603.1| conserved peptide upstream open reading fram... 62 6e-08 ref|NP_001118342.1| uncharacterized protein [Arabidopsis thalian... 60 4e-07 ref|XP_003603971.1| BZIP transcription factor ATB2 [Medicago tru... 59 8e-07 >ref|NP_001119115.1| conserved peptide upstream open reading frame 2 [Arabidopsis thaliana] gi|332660996|gb|AEE86396.1| conserved peptide upstream open reading frame 2 [Arabidopsis thaliana] Length = 42 Score = 76.6 bits (187), Expect = 3e-12 Identities = 38/42 (90%), Positives = 40/42 (95%), Gaps = 1/42 (2%) Frame = +3 Query: 312 MSPI-LSEIFLSGYMINSTFRRRTHLVQSFSVVFLYWLYYVS 434 MSPI LSEIFLSG+M+NST RRRTHLVQSFSVVFLYWLYYVS Sbjct: 1 MSPIILSEIFLSGFMLNSTIRRRTHLVQSFSVVFLYWLYYVS 42 >ref|XP_006362036.1| PREDICTED: uncharacterized protein LOC102590957 [Solanum tuberosum] Length = 41 Score = 75.9 bits (185), Expect = 5e-12 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = +3 Query: 312 MSPILSEIFLSGYMINSTFRRRTHLVQSFSVVFLYWLYYVS 434 MS ILSE+FLSG+MINST+RRRTHLVQSFSVVFLYW Y++S Sbjct: 1 MSAILSELFLSGFMINSTYRRRTHLVQSFSVVFLYWFYFIS 41 >ref|XP_004507476.1| PREDICTED: uncharacterized protein LOC101515270 [Cicer arietinum] gi|561009041|gb|ESW07948.1| hypothetical protein PHAVU_009G005900g [Phaseolus vulgaris] Length = 41 Score = 74.3 bits (181), Expect = 1e-11 Identities = 36/41 (87%), Positives = 36/41 (87%) Frame = +3 Query: 312 MSPILSEIFLSGYMINSTFRRRTHLVQSFSVVFLYWLYYVS 434 M PILSEIF SG MINST RRRTHLVQSFSV FLYWLYYVS Sbjct: 1 MYPILSEIFFSGCMINSTVRRRTHLVQSFSVAFLYWLYYVS 41 >ref|XP_004289641.1| PREDICTED: uncharacterized protein LOC101313460 [Fragaria vesca subsp. vesca] Length = 41 Score = 73.2 bits (178), Expect = 3e-11 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = +3 Query: 312 MSPILSEIFLSGYMINSTFRRRTHLVQSFSVVFLYWLYYVS 434 MSP LSE+ LS MINST+RRRTHLVQSFSVVFLYWLYYVS Sbjct: 1 MSPTLSELLLSECMINSTYRRRTHLVQSFSVVFLYWLYYVS 41 >ref|XP_004500792.1| PREDICTED: uncharacterized protein LOC101488322 [Cicer arietinum] Length = 41 Score = 72.8 bits (177), Expect = 4e-11 Identities = 36/41 (87%), Positives = 36/41 (87%) Frame = +3 Query: 312 MSPILSEIFLSGYMINSTFRRRTHLVQSFSVVFLYWLYYVS 434 M ILSEIF SG MINST RRRTHLVQSFSVVFLYWLYYVS Sbjct: 1 MYQILSEIFFSGCMINSTVRRRTHLVQSFSVVFLYWLYYVS 41 >ref|XP_004248699.1| PREDICTED: uncharacterized protein LOC101260774 [Solanum lycopersicum] Length = 41 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = +3 Query: 312 MSPILSEIFLSGYMINSTFRRRTHLVQSFSVVFLYWLYYVS 434 MS IL+E+FL G+MINST+RRRTHLVQSFSVVFLYW Y +S Sbjct: 1 MSAILNELFLCGFMINSTYRRRTHLVQSFSVVFLYWFYCIS 41 >gb|ESW03793.1| hypothetical protein PHAVU_011G042700g [Phaseolus vulgaris] Length = 41 Score = 70.5 bits (171), Expect = 2e-10 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = +3 Query: 312 MSPILSEIFLSGYMINSTFRRRTHLVQSFSVVFLYWLYYVS 434 M ILSE+F SG MINST RRRTHLVQSFSV FLYWLYYVS Sbjct: 1 MYSILSELFFSGCMINSTVRRRTHLVQSFSVAFLYWLYYVS 41 >ref|XP_003544337.1| PREDICTED: uncharacterized protein LOC100799960 [Glycine max] gi|356564302|ref|XP_003550394.1| PREDICTED: uncharacterized protein LOC100799844 [Glycine max] gi|561034189|gb|ESW32719.1| hypothetical protein PHAVU_001G011900g [Phaseolus vulgaris] Length = 41 Score = 68.9 bits (167), Expect = 6e-10 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = +3 Query: 312 MSPILSEIFLSGYMINSTFRRRTHLVQSFSVVFLYWLYYVS 434 MSP+LSEI SG+MINS+ RRRTHLVQSFSVVFLYW Y S Sbjct: 1 MSPVLSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS 41 >gb|EOY14848.1| Peptide upstream open reading frame 5 [Theobroma cacao] Length = 41 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = +3 Query: 312 MSPILSEIFLSGYMINSTFRRRTHLVQSFSVVFLYWLYYVS 434 MSP++SEI SG+MINS+ RRRTHLVQSFSVVFLYW Y S Sbjct: 1 MSPVVSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_004500982.1| PREDICTED: uncharacterized protein LOC101493326 [Cicer arietinum] Length = 54 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = +3 Query: 312 MSPILSEIFLSGYMINSTFRRRTHLVQSFSVVFLYWLYYVS 434 MS ILSE LSG++INS+FRRRTHLVQSFS+VFLYW Y S Sbjct: 1 MSTILSEFLLSGFIINSSFRRRTHLVQSFSLVFLYWFYVFS 41 >ref|XP_006340664.1| PREDICTED: uncharacterized protein LOC102593404 [Solanum tuberosum] Length = 41 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = +3 Query: 312 MSPILSEIFLSGYMINSTFRRRTHLVQSFSVVFLYWLYYVS 434 M+P++SE+ LSG+ INST RR THLVQSFSVVFLYW Y S Sbjct: 1 MTPVISEVLLSGFTINSTLRRGTHLVQSFSVVFLYWFYVFS 41 >ref|XP_002887590.1| expressed protein [Arabidopsis lyrata subsp. lyrata] gi|297333431|gb|EFH63849.1| expressed protein [Arabidopsis lyrata subsp. lyrata] Length = 53 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = +3 Query: 309 FMSPILSEIFLSGYMINSTFRRRTHLVQSFSVVFLYWLYYVS 434 FMSP++SEI SG I+S+ RRRTHLVQSFSVVFLYW Y S Sbjct: 12 FMSPVISEILRSGLTIDSSLRRRTHLVQSFSVVFLYWFYVFS 53 >gb|ESW31431.1| hypothetical protein PHAVU_002G237700g [Phaseolus vulgaris] Length = 42 Score = 64.3 bits (155), Expect = 1e-08 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = +3 Query: 315 SPILSEIFLSGYMINSTFRRRTHLVQSFSVVFLYWLYYVS 434 SP++SEI LSG+ INS+ RRRTHLVQSFSVVFL+W Y S Sbjct: 3 SPVISEILLSGFTINSSLRRRTHLVQSFSVVFLHWFYVFS 42 >ref|XP_004499194.1| PREDICTED: uncharacterized protein LOC101496764 [Cicer arietinum] Length = 41 Score = 64.3 bits (155), Expect = 1e-08 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = +3 Query: 312 MSPILSEIFLSGYMINSTFRRRTHLVQSFSVVFLYWLYYVS 434 MSP+LSEI SG++I+S+ +RRTHLVQSFSVVFLYW Y S Sbjct: 1 MSPVLSEILRSGFIIDSSLKRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_004504309.1| PREDICTED: uncharacterized protein LOC101502371 [Cicer arietinum] Length = 39 Score = 63.5 bits (153), Expect = 2e-08 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = +3 Query: 312 MSPILSEIFLSGYMINSTFRRRTHLVQSFSVVFLYWLYYVS 434 MSP++ EI SG+MINST RRRTHLVQSFSVVFLYW Y S Sbjct: 1 MSPVICEI--SGFMINSTLRRRTHLVQSFSVVFLYWFYIFS 39 >ref|XP_004973272.1| PREDICTED: basic leucine zipper 9-like isoform X2 [Setaria italica] Length = 147 Score = 62.8 bits (151), Expect = 4e-08 Identities = 31/41 (75%), Positives = 32/41 (78%) Frame = +3 Query: 312 MSPILSEIFLSGYMINSTFRRRTHLVQSFSVVFLYWLYYVS 434 MS ILSE LSG+MINST RR THLV SFSVVFLYW Y S Sbjct: 1 MSQILSEAILSGFMINSTLRRGTHLVLSFSVVFLYWFYVFS 41 >ref|NP_001117603.1| conserved peptide upstream open reading frame 5 [Arabidopsis thaliana] gi|332197591|gb|AEE35712.1| conserved peptide upstream open reading frame 5 [Arabidopsis thaliana] Length = 41 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = +3 Query: 312 MSPILSEIFLSGYMINSTFRRRTHLVQSFSVVFLYWLYYVS 434 MSP++SEI SG I+S+ RRRTHLVQSFSVVFLYW Y S Sbjct: 1 MSPVISEILRSGLTIDSSLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|NP_001118342.1| uncharacterized protein [Arabidopsis thaliana] gi|330251639|gb|AEC06733.1| uncharacterized protein AT2G18162 [Arabidopsis thaliana] Length = 41 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/41 (68%), Positives = 31/41 (75%) Frame = +3 Query: 312 MSPILSEIFLSGYMINSTFRRRTHLVQSFSVVFLYWLYYVS 434 M+P+L EI LSG + S RRTHLVQSFSVVFLYW Y VS Sbjct: 1 MTPVLCEILLSGLTVKSALCRRTHLVQSFSVVFLYWFYNVS 41 >ref|XP_003603971.1| BZIP transcription factor ATB2 [Medicago truncatula] gi|355493019|gb|AES74222.1| BZIP transcription factor ATB2 [Medicago truncatula] Length = 209 Score = 58.5 bits (140), Expect = 8e-07 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = +3 Query: 312 MSPILSEIFLSGYMINSTFRRRTHLVQSFSVVFLY 416 M ILSEIF SG MINST RRRTHLVQSFSVVFLY Sbjct: 1 MYQILSEIFFSGCMINSTVRRRTHLVQSFSVVFLY 35