BLASTX nr result
ID: Jatropha_contig00043427
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00043427 (278 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521079.1| conserved hypothetical protein [Ricinus comm... 64 3e-08 gb|EOX93904.1| Small ubiquitin-like modifier 1, 1,SUMO1,ATSUMO1 ... 62 6e-08 ref|XP_006357964.1| PREDICTED: small ubiquitin-related modifier ... 62 1e-07 ref|XP_002321284.1| predicted protein [Populus trichocarpa] gi|1... 62 1e-07 gb|EOX93329.1| Small ubiquitin-like modifier 1, 1,SUMO1,ATSUMO1,... 61 1e-07 ref|XP_004243516.1| PREDICTED: small ubiquitin-related modifier ... 61 1e-07 gb|ESW12631.1| hypothetical protein PHAVU_008G129000g [Phaseolus... 61 2e-07 gb|AGV54400.1| small ubiquitin-related modifier 2-like protein [... 61 2e-07 gb|EMT26959.1| hypothetical protein F775_32079 [Aegilops tauschii] 61 2e-07 ref|XP_003552121.1| PREDICTED: small ubiquitin-related modifier ... 61 2e-07 ref|NP_001235592.1| uncharacterized protein LOC100305708 [Glycin... 61 2e-07 gb|ERM99312.1| hypothetical protein AMTR_s00228p00023500 [Ambore... 60 2e-07 ref|XP_002274949.1| PREDICTED: uncharacterized protein LOC100267... 60 2e-07 gb|ESR60882.1| hypothetical protein CICLE_v10017283mg [Citrus cl... 60 3e-07 gb|ESR60881.1| hypothetical protein CICLE_v10017283mg [Citrus cl... 60 3e-07 gb|ESR56828.1| hypothetical protein CICLE_v10022993mg [Citrus cl... 60 3e-07 gb|ESR56827.1| hypothetical protein CICLE_v10022993mg [Citrus cl... 60 3e-07 gb|ESQ54587.1| hypothetical protein EUTSA_v10026654mg [Eutrema s... 60 3e-07 ref|XP_006281365.1| hypothetical protein CARUB_v10027422mg [Caps... 60 3e-07 ref|NP_200327.1| small ubiquitin-related modifier 2 [Arabidopsis... 60 3e-07 >ref|XP_002521079.1| conserved hypothetical protein [Ricinus communis] gi|223539648|gb|EEF41230.1| conserved hypothetical protein [Ricinus communis] Length = 108 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +1 Query: 1 RRLRGEQTPDELEMEDGDETDTMLHQTGGGNVY 99 RRLRGEQTPDELEMEDGDE D MLHQTGGG+ + Sbjct: 75 RRLRGEQTPDELEMEDGDEIDAMLHQTGGGDAH 107 >gb|EOX93904.1| Small ubiquitin-like modifier 1, 1,SUMO1,ATSUMO1 [Theobroma cacao] Length = 109 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +1 Query: 1 RRLRGEQTPDELEMEDGDETDTMLHQTGGG 90 RRLRGEQTPDELEMEDGDE D MLHQTGGG Sbjct: 74 RRLRGEQTPDELEMEDGDEIDAMLHQTGGG 103 >ref|XP_006357964.1| PREDICTED: small ubiquitin-related modifier 1-like [Solanum tuberosum] Length = 96 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = +1 Query: 1 RRLRGEQTPDELEMEDGDETDTMLHQTGGGNV 96 RRLRGEQTPDELEMEDGDE D MLHQTGG V Sbjct: 65 RRLRGEQTPDELEMEDGDEIDAMLHQTGGSTV 96 >ref|XP_002321284.1| predicted protein [Populus trichocarpa] gi|118487404|gb|ABK95530.1| unknown [Populus trichocarpa] gi|222862057|gb|EEE99599.1| hypothetical protein POPTR_0014s18990g [Populus trichocarpa] Length = 108 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +1 Query: 1 RRLRGEQTPDELEMEDGDETDTMLHQTGGGN 93 RRLRGEQTPDEL+MEDGDE D MLHQTGGG+ Sbjct: 74 RRLRGEQTPDELDMEDGDEIDAMLHQTGGGH 104 >gb|EOX93329.1| Small ubiquitin-like modifier 1, 1,SUMO1,ATSUMO1, partial [Theobroma cacao] Length = 133 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = +1 Query: 1 RRLRGEQTPDELEMEDGDETDTMLHQTGGGN 93 RRLRGEQTPDELEMEDGDE D MLHQTGG N Sbjct: 95 RRLRGEQTPDELEMEDGDEIDAMLHQTGGVN 125 >ref|XP_004243516.1| PREDICTED: small ubiquitin-related modifier 1-like [Solanum lycopersicum] Length = 96 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +1 Query: 1 RRLRGEQTPDELEMEDGDETDTMLHQTGGGNV 96 RRLRGEQTPDELEMEDGDE D MLHQTGG + Sbjct: 65 RRLRGEQTPDELEMEDGDEIDAMLHQTGGSTI 96 >gb|ESW12631.1| hypothetical protein PHAVU_008G129000g [Phaseolus vulgaris] Length = 103 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +1 Query: 1 RRLRGEQTPDELEMEDGDETDTMLHQTGGGNVY 99 RRLR EQTPDELEMEDGDE D MLHQTGGG+ + Sbjct: 70 RRLRAEQTPDELEMEDGDEIDAMLHQTGGGHKF 102 >gb|AGV54400.1| small ubiquitin-related modifier 2-like protein [Phaseolus vulgaris] Length = 128 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +1 Query: 1 RRLRGEQTPDELEMEDGDETDTMLHQTGGGNVY 99 RRLR EQTPDELEMEDGDE D MLHQTGGG+ + Sbjct: 70 RRLRAEQTPDELEMEDGDEIDAMLHQTGGGHKF 102 >gb|EMT26959.1| hypothetical protein F775_32079 [Aegilops tauschii] Length = 116 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +1 Query: 1 RRLRGEQTPDELEMEDGDETDTMLHQTGGG 90 RRLRGEQTPDELEME+GDE D MLHQTGGG Sbjct: 83 RRLRGEQTPDELEMEEGDEIDAMLHQTGGG 112 >ref|XP_003552121.1| PREDICTED: small ubiquitin-related modifier 2-like [Glycine max] Length = 114 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +1 Query: 1 RRLRGEQTPDELEMEDGDETDTMLHQTGGGNVY 99 RRLR EQTPDELEMEDGDE D MLHQTGGG+ + Sbjct: 70 RRLRAEQTPDELEMEDGDEIDAMLHQTGGGHKF 102 >ref|NP_001235592.1| uncharacterized protein LOC100305708 [Glycine max] gi|255626371|gb|ACU13530.1| unknown [Glycine max] Length = 103 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +1 Query: 1 RRLRGEQTPDELEMEDGDETDTMLHQTGGGNVY 99 RRLR EQTPDELEMEDGDE D MLHQTGGG+ + Sbjct: 70 RRLRAEQTPDELEMEDGDEIDAMLHQTGGGHKF 102 >gb|ERM99312.1| hypothetical protein AMTR_s00228p00023500 [Amborella trichopoda] Length = 98 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +1 Query: 1 RRLRGEQTPDELEMEDGDETDTMLHQTGGGN 93 RRLRGEQTPDELEMEDGDE D MLHQTGG + Sbjct: 66 RRLRGEQTPDELEMEDGDEIDAMLHQTGGSD 96 >ref|XP_002274949.1| PREDICTED: uncharacterized protein LOC100267064 [Vitis vinifera] gi|297739210|emb|CBI28861.3| unnamed protein product [Vitis vinifera] Length = 101 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = +1 Query: 1 RRLRGEQTPDELEMEDGDETDTMLHQTGGGNV 96 RRLRGEQTPDELEMEDGDE D MLHQTGG V Sbjct: 70 RRLRGEQTPDELEMEDGDEIDAMLHQTGGACV 101 >gb|ESR60882.1| hypothetical protein CICLE_v10017283mg [Citrus clementina] Length = 101 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 1 RRLRGEQTPDELEMEDGDETDTMLHQTGG 87 RRLRGEQTPDELEMEDGDE D MLHQTGG Sbjct: 69 RRLRGEQTPDELEMEDGDEIDAMLHQTGG 97 >gb|ESR60881.1| hypothetical protein CICLE_v10017283mg [Citrus clementina] Length = 97 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 1 RRLRGEQTPDELEMEDGDETDTMLHQTGG 87 RRLRGEQTPDELEMEDGDE D MLHQTGG Sbjct: 65 RRLRGEQTPDELEMEDGDEIDAMLHQTGG 93 >gb|ESR56828.1| hypothetical protein CICLE_v10022993mg [Citrus clementina] Length = 79 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 1 RRLRGEQTPDELEMEDGDETDTMLHQTGG 87 RRLRGEQTPDELEMEDGDE D MLHQTGG Sbjct: 46 RRLRGEQTPDELEMEDGDEIDAMLHQTGG 74 >gb|ESR56827.1| hypothetical protein CICLE_v10022993mg [Citrus clementina] Length = 105 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +1 Query: 1 RRLRGEQTPDELEMEDGDETDTMLHQTGG 87 RRLRGEQTPDELEMEDGDE D MLHQTGG Sbjct: 72 RRLRGEQTPDELEMEDGDEIDAMLHQTGG 100 >gb|ESQ54587.1| hypothetical protein EUTSA_v10026654mg [Eutrema salsugineum] Length = 101 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +1 Query: 1 RRLRGEQTPDELEMEDGDETDTMLHQTGGG 90 RRLR EQTPDELEMEDGDE D MLHQTGGG Sbjct: 65 RRLRAEQTPDELEMEDGDEIDAMLHQTGGG 94 >ref|XP_006281365.1| hypothetical protein CARUB_v10027422mg [Capsella rubella] gi|482550069|gb|EOA14263.1| hypothetical protein CARUB_v10027422mg [Capsella rubella] Length = 103 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +1 Query: 1 RRLRGEQTPDELEMEDGDETDTMLHQTGGG 90 RRLR EQTPDELEMEDGDE D MLHQTGGG Sbjct: 64 RRLRAEQTPDELEMEDGDEIDAMLHQTGGG 93 >ref|NP_200327.1| small ubiquitin-related modifier 2 [Arabidopsis thaliana] gi|75171511|sp|Q9FLP6.1|SUMO2_ARATH RecName: Full=Small ubiquitin-related modifier 2; Short=AtSUMO2 gi|9758113|dbj|BAB08585.1| ubiquitin-like protein SMT3-like [Arabidopsis thaliana] gi|19715611|gb|AAL91628.1| AT5g55160/MCO15_11 [Arabidopsis thaliana] gi|21360423|gb|AAM47327.1| AT5g55160/MCO15_11 [Arabidopsis thaliana] gi|21537401|gb|AAM61742.1| ubiquitin-like protein SMT3-like [Arabidopsis thaliana] gi|22652844|gb|AAN03846.1| small ubiquitin-like modifier 2 [Arabidopsis thaliana] gi|332009210|gb|AED96593.1| small ubiquitin-related modifier 2 [Arabidopsis thaliana] Length = 103 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +1 Query: 1 RRLRGEQTPDELEMEDGDETDTMLHQTGGG 90 RRLR EQTPDELEMEDGDE D MLHQTGGG Sbjct: 64 RRLRAEQTPDELEMEDGDEIDAMLHQTGGG 93