BLASTX nr result
ID: Jatropha_contig00043261
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00043261 (872 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERP63524.1| hypothetical protein POPTR_0003s11060g [Populus t... 57 8e-06 ref|XP_002303511.1| predicted protein [Populus trichocarpa] 57 8e-06 >gb|ERP63524.1| hypothetical protein POPTR_0003s11060g [Populus trichocarpa] Length = 234 Score = 57.0 bits (136), Expect = 8e-06 Identities = 29/46 (63%), Positives = 34/46 (73%) Frame = -3 Query: 489 GNPVANVCCPVIKGLLELEAAVGVCHNYKALSFLISTFSFPLALQV 352 GNPV NVCCPV+KGLLELEAA+ +C + + L L T PLALQV Sbjct: 173 GNPVENVCCPVLKGLLELEAAICLCTSIR-LKLLNLTIFIPLALQV 217 >ref|XP_002303511.1| predicted protein [Populus trichocarpa] Length = 104 Score = 57.0 bits (136), Expect = 8e-06 Identities = 29/46 (63%), Positives = 34/46 (73%) Frame = -3 Query: 489 GNPVANVCCPVIKGLLELEAAVGVCHNYKALSFLISTFSFPLALQV 352 GNPV NVCCPV+KGLLELEAA+ +C + + L L T PLALQV Sbjct: 45 GNPVENVCCPVLKGLLELEAAICLCTSIR-LKLLNLTIFIPLALQV 89