BLASTX nr result
ID: Jatropha_contig00043101
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00043101 (838 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOX95584.1| Pentatricopeptide repeat-containing protein, mito... 89 2e-15 gb|ESR57964.1| hypothetical protein CICLE_v10023955mg, partial [... 88 3e-15 ref|XP_003626608.1| Pentatricopeptide repeat-containing protein ... 86 2e-14 ref|XP_003520884.1| PREDICTED: conserved oligomeric Golgi comple... 85 3e-14 gb|ESW11013.1| hypothetical protein PHAVU_009G258200g, partial [... 84 6e-14 ref|XP_004494974.1| PREDICTED: conserved oligomeric Golgi comple... 84 8e-14 emb|CAN72416.1| hypothetical protein VITISV_027905 [Vitis vinifera] 83 1e-13 ref|XP_004251386.1| PREDICTED: pentatricopeptide repeat-containi... 83 1e-13 ref|XP_002267721.2| PREDICTED: conserved oligomeric Golgi comple... 83 1e-13 emb|CBI38715.3| unnamed protein product [Vitis vinifera] 83 1e-13 ref|XP_006362890.1| PREDICTED: pentatricopeptide repeat-containi... 82 2e-13 gb|AHB18410.1| pentatricopeptide repeat-containing protein [Goss... 82 2e-13 ref|XP_002320901.1| predicted protein [Populus trichocarpa] 82 2e-13 ref|XP_004138384.1| PREDICTED: pentatricopeptide repeat-containi... 82 3e-13 gb|EEE99216.2| hypothetical protein POPTR_0014s10150g [Populus t... 79 2e-12 gb|EPS71710.1| hypothetical protein M569_03047, partial [Genlise... 75 2e-11 gb|EMJ20615.1| hypothetical protein PRUPE_ppa021922mg [Prunus pe... 75 4e-11 ref|XP_006286848.1| hypothetical protein CARUB_v10003876mg [Caps... 74 6e-11 ref|XP_002872894.1| pentatricopeptide repeat-containing protein ... 74 8e-11 gb|AAC19289.1| contains similarity to Arabidopsis membrane-assoc... 72 2e-10 >gb|EOX95584.1| Pentatricopeptide repeat-containing protein, mitochondrial [Theobroma cacao] Length = 461 Score = 89.0 bits (219), Expect = 2e-15 Identities = 42/64 (65%), Positives = 48/64 (75%) Frame = +1 Query: 25 SYIIKIYGEANLPDKVLKTFYKMLAFNCKPLPKQLNLILEFIVSHRNYRKPALHLITNEP 204 SY+IKIY EANLP++ LKTFYKML FN KPLPK LN ILE +VSHRN+ PA L N Sbjct: 125 SYLIKIYAEANLPERALKTFYKMLEFNIKPLPKHLNRILELLVSHRNFLMPAFDLFKNAH 184 Query: 205 KYAV 216 K+ V Sbjct: 185 KHGV 188 >gb|ESR57964.1| hypothetical protein CICLE_v10023955mg, partial [Citrus clementina] Length = 423 Score = 88.2 bits (217), Expect = 3e-15 Identities = 40/64 (62%), Positives = 49/64 (76%) Frame = +1 Query: 25 SYIIKIYGEANLPDKVLKTFYKMLAFNCKPLPKQLNLILEFIVSHRNYRKPALHLITNEP 204 +Y+IKIY E+NLPD+ LKTF ML FNCKPLPKQLN ILE +V+HRNY +PA L + Sbjct: 134 TYLIKIYAESNLPDRALKTFRSMLEFNCKPLPKQLNRILELLVTHRNYLRPAFDLFKSAH 193 Query: 205 KYAV 216 K+ V Sbjct: 194 KHGV 197 >ref|XP_003626608.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|87240852|gb|ABD32710.1| Tetratricopeptide-like helical [Medicago truncatula] gi|355501623|gb|AES82826.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 451 Score = 85.5 bits (210), Expect = 2e-14 Identities = 41/64 (64%), Positives = 47/64 (73%) Frame = +1 Query: 25 SYIIKIYGEANLPDKVLKTFYKMLAFNCKPLPKQLNLILEFIVSHRNYRKPALHLITNEP 204 SY+IKIYGEANLPDK L TFY ML FN KPL K LN IL+ +VSHRNY +PA L + Sbjct: 115 SYLIKIYGEANLPDKALNTFYIMLQFNIKPLTKHLNRILDILVSHRNYLRPAFDLFKDAH 174 Query: 205 KYAV 216 K+ V Sbjct: 175 KHGV 178 >ref|XP_003520884.1| PREDICTED: conserved oligomeric Golgi complex subunit 4-like [Glycine max] Length = 1114 Score = 84.7 bits (208), Expect = 3e-14 Identities = 37/64 (57%), Positives = 49/64 (76%) Frame = +1 Query: 25 SYIIKIYGEANLPDKVLKTFYKMLAFNCKPLPKQLNLILEFIVSHRNYRKPALHLITNEP 204 +Y+IK+Y EA+LPDK L +FY +L FNCKPLPK LN ILE +VSHRN+ +PA +L + Sbjct: 131 TYLIKVYAEADLPDKALNSFYTILHFNCKPLPKHLNRILEVLVSHRNFIRPAFYLFKDAH 190 Query: 205 KYAV 216 +Y V Sbjct: 191 RYGV 194 >gb|ESW11013.1| hypothetical protein PHAVU_009G258200g, partial [Phaseolus vulgaris] Length = 418 Score = 84.0 bits (206), Expect = 6e-14 Identities = 37/64 (57%), Positives = 49/64 (76%) Frame = +1 Query: 25 SYIIKIYGEANLPDKVLKTFYKMLAFNCKPLPKQLNLILEFIVSHRNYRKPALHLITNEP 204 +Y+I++Y EA+LP+K LKTFY +L F+CKPLPK LN ILE +VSHRNY +PA L + Sbjct: 82 TYLIRVYAEADLPEKALKTFYNILHFDCKPLPKHLNRILELLVSHRNYIRPAFLLFKDAH 141 Query: 205 KYAV 216 +Y V Sbjct: 142 RYGV 145 >ref|XP_004494974.1| PREDICTED: conserved oligomeric Golgi complex subunit 4-like [Cicer arietinum] Length = 1302 Score = 83.6 bits (205), Expect = 8e-14 Identities = 39/64 (60%), Positives = 47/64 (73%) Frame = +1 Query: 25 SYIIKIYGEANLPDKVLKTFYKMLAFNCKPLPKQLNLILEFIVSHRNYRKPALHLITNEP 204 SY+I+IY +A+LPDK L TFY ML FNCKPL K LN IL F+VSHRNY +PA L + Sbjct: 126 SYLIQIYAQADLPDKALNTFYTMLQFNCKPLTKHLNRILVFLVSHRNYVRPAFDLFKDAH 185 Query: 205 KYAV 216 K+ V Sbjct: 186 KHGV 189 >emb|CAN72416.1| hypothetical protein VITISV_027905 [Vitis vinifera] Length = 422 Score = 83.2 bits (204), Expect = 1e-13 Identities = 39/65 (60%), Positives = 49/65 (75%) Frame = +1 Query: 25 SYIIKIYGEANLPDKVLKTFYKMLAFNCKPLPKQLNLILEFIVSHRNYRKPALHLITNEP 204 S II+IYGEANLPD+ LKTF+ ML F+ KPLPK LN +L+ +VSHRNY +PA L + Sbjct: 86 SDIIEIYGEANLPDQALKTFHSMLQFHSKPLPKHLNXLLQLLVSHRNYIRPAFDLFKSAH 145 Query: 205 KYAVS 219 +Y VS Sbjct: 146 RYGVS 150 >ref|XP_004251386.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01400, mitochondrial-like [Solanum lycopersicum] Length = 479 Score = 82.8 bits (203), Expect = 1e-13 Identities = 38/64 (59%), Positives = 48/64 (75%) Frame = +1 Query: 25 SYIIKIYGEANLPDKVLKTFYKMLAFNCKPLPKQLNLILEFIVSHRNYRKPALHLITNEP 204 S+II+IYG+A LPD+ LKTFY +L FN KPLPK LNLILE +V+HRN+ +PA L + Sbjct: 143 SHIIQIYGDAGLPDRALKTFYTILEFNMKPLPKHLNLILEILVTHRNFLRPAFDLFRSAH 202 Query: 205 KYAV 216 Y V Sbjct: 203 TYGV 206 >ref|XP_002267721.2| PREDICTED: conserved oligomeric Golgi complex subunit 4-like [Vitis vinifera] Length = 1105 Score = 82.8 bits (203), Expect = 1e-13 Identities = 39/65 (60%), Positives = 49/65 (75%) Frame = +1 Query: 25 SYIIKIYGEANLPDKVLKTFYKMLAFNCKPLPKQLNLILEFIVSHRNYRKPALHLITNEP 204 S II+IYGEANLPD+ LKTF+ ML F+ KPLPK LN +L+ +VSHRNY +PA L + Sbjct: 117 SDIIEIYGEANLPDQALKTFHSMLQFHSKPLPKHLNRLLQLLVSHRNYIRPAFDLFKSAH 176 Query: 205 KYAVS 219 +Y VS Sbjct: 177 RYGVS 181 >emb|CBI38715.3| unnamed protein product [Vitis vinifera] Length = 429 Score = 82.8 bits (203), Expect = 1e-13 Identities = 39/65 (60%), Positives = 49/65 (75%) Frame = +1 Query: 25 SYIIKIYGEANLPDKVLKTFYKMLAFNCKPLPKQLNLILEFIVSHRNYRKPALHLITNEP 204 S II+IYGEANLPD+ LKTF+ ML F+ KPLPK LN +L+ +VSHRNY +PA L + Sbjct: 131 SDIIEIYGEANLPDQALKTFHSMLQFHSKPLPKHLNRLLQLLVSHRNYIRPAFDLFKSAH 190 Query: 205 KYAVS 219 +Y VS Sbjct: 191 RYGVS 195 >ref|XP_006362890.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01400, mitochondrial-like [Solanum tuberosum] Length = 479 Score = 82.4 bits (202), Expect = 2e-13 Identities = 39/64 (60%), Positives = 47/64 (73%) Frame = +1 Query: 25 SYIIKIYGEANLPDKVLKTFYKMLAFNCKPLPKQLNLILEFIVSHRNYRKPALHLITNEP 204 S II+IYG+A LPDK LKTFY +L FN KPLPK LNLILE +V+HRN+ +PA L + Sbjct: 143 SRIIQIYGDAGLPDKALKTFYTILEFNMKPLPKHLNLILEILVTHRNFLRPAFDLFRSAH 202 Query: 205 KYAV 216 Y V Sbjct: 203 TYGV 206 >gb|AHB18410.1| pentatricopeptide repeat-containing protein [Gossypium hirsutum] Length = 458 Score = 82.4 bits (202), Expect = 2e-13 Identities = 39/64 (60%), Positives = 45/64 (70%) Frame = +1 Query: 25 SYIIKIYGEANLPDKVLKTFYKMLAFNCKPLPKQLNLILEFIVSHRNYRKPALHLITNEP 204 SY+IKIY EA+LP+K L FYKML FN KPLP+ LN ILE +VSHRN+ PA L Sbjct: 124 SYLIKIYAEADLPEKALSVFYKMLEFNVKPLPRHLNRILELLVSHRNFIMPAFDLFKTAH 183 Query: 205 KYAV 216 KY V Sbjct: 184 KYGV 187 >ref|XP_002320901.1| predicted protein [Populus trichocarpa] Length = 475 Score = 82.4 bits (202), Expect = 2e-13 Identities = 40/64 (62%), Positives = 45/64 (70%) Frame = +1 Query: 25 SYIIKIYGEANLPDKVLKTFYKMLAFNCKPLPKQLNLILEFIVSHRNYRKPALHLITNEP 204 SYII IYGEANLPDK LK FY +L F+C P PK LN ILE +VSH+NY KPA L + Sbjct: 139 SYIINIYGEANLPDKALKIFYTILKFDCNPSPKHLNGILEILVSHQNYIKPAFDLFKDAH 198 Query: 205 KYAV 216 Y V Sbjct: 199 TYDV 202 >ref|XP_004138384.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01400, mitochondrial-like [Cucumis sativus] gi|449499186|ref|XP_004160743.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01400, mitochondrial-like [Cucumis sativus] Length = 482 Score = 81.6 bits (200), Expect = 3e-13 Identities = 39/64 (60%), Positives = 45/64 (70%) Frame = +1 Query: 25 SYIIKIYGEANLPDKVLKTFYKMLAFNCKPLPKQLNLILEFIVSHRNYRKPALHLITNEP 204 SYIIKIYGEA+LPDK LK FY M+ F C P KQLN ILE +VSHRN+ +PA L N Sbjct: 145 SYIIKIYGEADLPDKALKVFYTMIDFGCTPSSKQLNRILEILVSHRNFIRPAFDLFKNAR 204 Query: 205 KYAV 216 + V Sbjct: 205 HHGV 208 >gb|EEE99216.2| hypothetical protein POPTR_0014s10150g [Populus trichocarpa] Length = 475 Score = 79.0 bits (193), Expect = 2e-12 Identities = 38/64 (59%), Positives = 44/64 (68%) Frame = +1 Query: 25 SYIIKIYGEANLPDKVLKTFYKMLAFNCKPLPKQLNLILEFIVSHRNYRKPALHLITNEP 204 SYII IYG+ANLPD+ LK FY +L F+C P PK LN ILE +VSH NY KPA L + Sbjct: 139 SYIINIYGKANLPDEALKIFYTILKFDCNPSPKHLNGILEILVSHHNYIKPAFDLFKDAH 198 Query: 205 KYAV 216 Y V Sbjct: 199 TYDV 202 >gb|EPS71710.1| hypothetical protein M569_03047, partial [Genlisea aurea] Length = 407 Score = 75.5 bits (184), Expect = 2e-11 Identities = 37/65 (56%), Positives = 45/65 (69%) Frame = +1 Query: 25 SYIIKIYGEANLPDKVLKTFYKMLAFNCKPLPKQLNLILEFIVSHRNYRKPALHLITNEP 204 S II+ YG+ANLPDK LKTFY +L FN KPL K LN ILE +VS+RN +PA + Sbjct: 83 SRIIRFYGDANLPDKALKTFYTILEFNMKPLRKHLNRILEILVSNRNLLRPAFDIFRAAH 142 Query: 205 KYAVS 219 +Y VS Sbjct: 143 RYGVS 147 >gb|EMJ20615.1| hypothetical protein PRUPE_ppa021922mg [Prunus persica] Length = 465 Score = 74.7 bits (182), Expect = 4e-11 Identities = 32/64 (50%), Positives = 47/64 (73%) Frame = +1 Query: 25 SYIIKIYGEANLPDKVLKTFYKMLAFNCKPLPKQLNLILEFIVSHRNYRKPALHLITNEP 204 +++IKIYGEANLP K L+TFY M+ F+C+P K LN IL+ +VSHRN+ +PA + + Sbjct: 128 AHLIKIYGEANLPQKALRTFYTMVEFDCRPSVKHLNRILQILVSHRNFLRPAFDVFKDAH 187 Query: 205 KYAV 216 ++ V Sbjct: 188 RHGV 191 >ref|XP_006286848.1| hypothetical protein CARUB_v10003876mg [Capsella rubella] gi|482555554|gb|EOA19746.1| hypothetical protein CARUB_v10003876mg [Capsella rubella] Length = 1116 Score = 73.9 bits (180), Expect = 6e-11 Identities = 34/65 (52%), Positives = 45/65 (69%) Frame = +1 Query: 25 SYIIKIYGEANLPDKVLKTFYKMLAFNCKPLPKQLNLILEFIVSHRNYRKPALHLITNEP 204 +Y+IK+Y EA LP+KVL+TFYKML FN P PK LN ILE +V+HR Y + A L + Sbjct: 129 TYLIKVYAEAKLPEKVLRTFYKMLEFNFTPQPKHLNRILEVLVNHRGYLRKAFELFKSSR 188 Query: 205 KYAVS 219 + V+ Sbjct: 189 LHGVT 193 >ref|XP_002872894.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297318731|gb|EFH49153.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 1162 Score = 73.6 bits (179), Expect = 8e-11 Identities = 34/64 (53%), Positives = 44/64 (68%) Frame = +1 Query: 25 SYIIKIYGEANLPDKVLKTFYKMLAFNCKPLPKQLNLILEFIVSHRNYRKPALHLITNEP 204 +Y+IK+Y EA +P+KVL+TFYKML FN P PK LN ILE +VSHR Y + A L + Sbjct: 125 TYLIKVYAEAKIPEKVLRTFYKMLEFNFTPQPKHLNRILEVLVSHRGYLQKAFELFKSSR 184 Query: 205 KYAV 216 + V Sbjct: 185 LHGV 188 >gb|AAC19289.1| contains similarity to Arabidopsis membrane-associated salt-inducible-like protein (GB:AL021637) [Arabidopsis thaliana] Length = 991 Score = 72.4 bits (176), Expect = 2e-10 Identities = 34/64 (53%), Positives = 43/64 (67%) Frame = +1 Query: 25 SYIIKIYGEANLPDKVLKTFYKMLAFNCKPLPKQLNLILEFIVSHRNYRKPALHLITNEP 204 +Y+IK+Y EA LP+KVL TFYKML FN P PK LN IL+ +VSHR Y + A L + Sbjct: 123 TYLIKVYAEAKLPEKVLSTFYKMLEFNFTPQPKHLNRILDVLVSHRGYLQKAFELFKSSR 182 Query: 205 KYAV 216 + V Sbjct: 183 LHGV 186