BLASTX nr result
ID: Jatropha_contig00043087
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00043087 (835 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBL87351.1| hypothetical protein S18_1082_0001 [uncultured F... 68 4e-09 gb|ADJ00052.1| chloramphenicol acetyltransferase [Promoter probe... 62 2e-07 ref|WP_004989554.1| conserved hypothetical protein [Streptomyces... 62 2e-07 ref|WP_007851439.1| hypothetical protein, partial [Bacteroides d... 60 1e-06 emb|CBL87507.1| hypothetical protein S18_873_0002 [uncultured Fl... 60 1e-06 emb|CAL37000.1| putative reverse transcriptase [Platanus x aceri... 60 1e-06 emb|CAD59768.1| putative reverse transcriptase [Cicer arietinum] 60 1e-06 ref|WP_001302813.1| hypothetical protein [Escherichia coli] gi|1... 57 6e-06 >emb|CBL87351.1| hypothetical protein S18_1082_0001 [uncultured Flavobacteriia bacterium] gi|330752692|emb|CBL88156.1| hypothetical protein S18_1087_0001 [uncultured Leeuwenhoekiella sp.] Length = 99 Score = 67.8 bits (164), Expect = 4e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 38 LGCLMSELTHINCVALTARFPVGKPVVPAALM 133 +GCLMSELTHINCVALTARFPVGKPVVPAALM Sbjct: 1 MGCLMSELTHINCVALTARFPVGKPVVPAALM 32 >gb|ADJ00052.1| chloramphenicol acetyltransferase [Promoter probe vector pEvoGlowRed] gi|299008154|gb|ADJ00076.1| chloramphenicol acetyltransferase [Reporter vector pGlowRed] Length = 339 Score = 62.4 bits (150), Expect = 2e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +2 Query: 44 CLMSELTHINCVALTARFPVGKPVVPAALM 133 CLMSELT+INCVALTARFPVGKPVVPAALM Sbjct: 255 CLMSELTYINCVALTARFPVGKPVVPAALM 284 >ref|WP_004989554.1| conserved hypothetical protein [Streptomyces ghanaensis] gi|118132570|gb|ABK60177.1| putative reverse transcriptase [Zingiber officinale] gi|291343216|gb|EFE70172.1| conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672] Length = 49 Score = 62.4 bits (150), Expect = 2e-07 Identities = 32/47 (68%), Positives = 33/47 (70%) Frame = +2 Query: 50 MSELTHINCVALTARFPVGKPVVPAALMYXXXXXXXXXXXXELYRFL 190 MSELTHINCVALTARFPVGKPVVPAALM L+RFL Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYWALFRFL 47 >ref|WP_007851439.1| hypothetical protein, partial [Bacteroides dorei] gi|392621938|gb|EIY16078.1| hypothetical protein HMPREF1063_05178, partial [Bacteroides dorei CL02T00C15] Length = 54 Score = 59.7 bits (143), Expect = 1e-06 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +2 Query: 50 MSELTHINCVALTARFPVGKPVVPAALM 133 MSELTHINCVALTARFPVGKPVVPAALM Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALM 28 >emb|CBL87507.1| hypothetical protein S18_873_0002 [uncultured Flavobacteriia bacterium] Length = 95 Score = 59.7 bits (143), Expect = 1e-06 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +2 Query: 50 MSELTHINCVALTARFPVGKPVVPAALM 133 MSELTHINCVALTARFPVGKPVVPAALM Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALM 28 >emb|CAL37000.1| putative reverse transcriptase [Platanus x acerifolia] Length = 30 Score = 59.7 bits (143), Expect = 1e-06 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +2 Query: 50 MSELTHINCVALTARFPVGKPVVPAALM 133 MSELTHINCVALTARFPVGKPVVPAALM Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALM 28 >emb|CAD59768.1| putative reverse transcriptase [Cicer arietinum] Length = 35 Score = 59.7 bits (143), Expect = 1e-06 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +2 Query: 50 MSELTHINCVALTARFPVGKPVVPAALM 133 MSELTHINCVALTARFPVGKPVVPAALM Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALM 28 >ref|WP_001302813.1| hypothetical protein [Escherichia coli] gi|189367716|gb|EDU86132.1| hypothetical protein ECH7EC4501_1546 [Escherichia coli O157:H7 str. EC4501] Length = 41 Score = 57.4 bits (137), Expect = 6e-06 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = -1 Query: 148 PRCPIH*GSWHDRFPDWKAGSERNAINVS*LTH 50 P H SWHD+FPDWKAGSERNAINVS LTH Sbjct: 9 PSLIFHLSSWHDKFPDWKAGSERNAINVSQLTH 41