BLASTX nr result
ID: Jatropha_contig00043084
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00043084 (850 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGJ52151.1| WRKY transcription factor 05 [Jatropha curcas] 53 6e-08 >gb|AGJ52151.1| WRKY transcription factor 05 [Jatropha curcas] Length = 477 Score = 52.8 bits (125), Expect(2) = 6e-08 Identities = 30/48 (62%), Positives = 35/48 (72%), Gaps = 1/48 (2%) Frame = +3 Query: 399 NKLSFPSPPIRQEDQSSAADVWKPKHLSIVGAAAMVLLSRA-*PMALM 539 NKLSFPSPP+ QED+SSAADV KP +LSIV M L+ PMAL+ Sbjct: 44 NKLSFPSPPLLQEDKSSAADVSKPNNLSIVPPPPMFSLTPGLSPMALL 91 Score = 31.2 bits (69), Expect(2) = 6e-08 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 272 MGLGFSPGPMTLV 310 MGLGFSPGPMTLV Sbjct: 1 MGLGFSPGPMTLV 13