BLASTX nr result
ID: Jatropha_contig00043070
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00043070 (837 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERP63524.1| hypothetical protein POPTR_0003s11060g [Populus t... 64 8e-08 ref|XP_002533296.1| conserved hypothetical protein [Ricinus comm... 64 8e-08 gb|EOY24386.1| Bifunctional inhibitor/lipid-transfer protein/see... 60 1e-06 >gb|ERP63524.1| hypothetical protein POPTR_0003s11060g [Populus trichocarpa] Length = 234 Score = 63.5 bits (153), Expect = 8e-08 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 3 LLFIFMIFMAISLPPIYACAPCTQPHPPGH 92 +LFIFMIFMAISLPPIYAC PCTQPHPP + Sbjct: 8 MLFIFMIFMAISLPPIYACTPCTQPHPPSY 37 >ref|XP_002533296.1| conserved hypothetical protein [Ricinus communis] gi|223526880|gb|EEF29090.1| conserved hypothetical protein [Ricinus communis] Length = 238 Score = 63.5 bits (153), Expect = 8e-08 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = +3 Query: 9 FIFMIFMAISLPPIYACAPCTQPHPPGH 92 FIFMIFMAISLPPIYAC PCTQPHPP H Sbjct: 11 FIFMIFMAISLPPIYACTPCTQPHPPSH 38 >gb|EOY24386.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein [Theobroma cacao] Length = 239 Score = 59.7 bits (143), Expect = 1e-06 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = +3 Query: 3 LLFIFMIFMAISLPPIYACAPCTQPHPP 86 L+FIF+IFM ISLPPIYAC PCTQPHPP Sbjct: 8 LIFIFLIFMLISLPPIYACVPCTQPHPP 35