BLASTX nr result
ID: Jatropha_contig00043047
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00043047 (528 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_005783315.1| conserved hypothetical protein, partial [Bac... 39 3e-06 ref|WP_008770322.1| hypothetical protein [Bacteroides sp. 2_1_16... 39 3e-06 >ref|WP_005783315.1| conserved hypothetical protein, partial [Bacteroides fragilis] gi|313138849|gb|EFR56208.1| LOW QUALITY PROTEIN: hypothetical protein BFAG_04907, partial [Bacteroides fragilis 3_1_12] Length = 98 Score = 39.3 bits (90), Expect(2) = 3e-06 Identities = 19/32 (59%), Positives = 21/32 (65%) Frame = -2 Query: 359 CVSQISSIFSLGRGLAGYLILFDPHACMGQCQ 264 C+SQ +SI L GL GYLILFD H QCQ Sbjct: 8 CISQTASIHRLLCGLPGYLILFDTHTFEHQCQ 39 Score = 37.4 bits (85), Expect(2) = 3e-06 Identities = 23/47 (48%), Positives = 26/47 (55%) Frame = -1 Query: 258 SSKLPWQLVFDVICNHFNATRLIALMSRVFKTDSIKGSFRGKAGDFT 118 SS+LP Q F VI HF AT I S V KTDSI +F + FT Sbjct: 42 SSELPSQSEFFVISKHFTATPRIPPTSTVLKTDSINCNFTVEPQTFT 88 >ref|WP_008770322.1| hypothetical protein [Bacteroides sp. 2_1_16] gi|263252188|gb|EEZ23745.1| hypothetical protein HMPREF0101_04583 [Bacteroides sp. 2_1_16] Length = 95 Score = 39.3 bits (90), Expect(2) = 3e-06 Identities = 19/32 (59%), Positives = 21/32 (65%) Frame = -2 Query: 359 CVSQISSIFSLGRGLAGYLILFDPHACMGQCQ 264 C+SQ +SI L GL GYLILFD H QCQ Sbjct: 5 CISQTASIHRLLCGLPGYLILFDTHTFEHQCQ 36 Score = 37.4 bits (85), Expect(2) = 3e-06 Identities = 23/47 (48%), Positives = 26/47 (55%) Frame = -1 Query: 258 SSKLPWQLVFDVICNHFNATRLIALMSRVFKTDSIKGSFRGKAGDFT 118 SS+LP Q F VI HF AT I S V KTDSI +F + FT Sbjct: 39 SSELPSQSEFFVISKHFTATPRIPPTSTVLKTDSINCNFTVEPQTFT 85