BLASTX nr result
ID: Jatropha_contig00043016
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00043016 (836 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERP63524.1| hypothetical protein POPTR_0003s11060g [Populus t... 68 3e-09 ref|XP_002533296.1| conserved hypothetical protein [Ricinus comm... 67 7e-09 gb|EOY24386.1| Bifunctional inhibitor/lipid-transfer protein/see... 63 1e-07 ref|XP_004151037.1| PREDICTED: uncharacterized protein LOC101220... 60 7e-07 >gb|ERP63524.1| hypothetical protein POPTR_0003s11060g [Populus trichocarpa] Length = 234 Score = 68.2 bits (165), Expect = 3e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +2 Query: 2 SKLEALLFIFMIFMAISLPPIYACAPCTQPHPPGH 106 SK A+LFIFMIFMAISLPPIYAC PCTQPHPP + Sbjct: 3 SKFAAMLFIFMIFMAISLPPIYACTPCTQPHPPSY 37 >ref|XP_002533296.1| conserved hypothetical protein [Ricinus communis] gi|223526880|gb|EEF29090.1| conserved hypothetical protein [Ricinus communis] Length = 238 Score = 67.0 bits (162), Expect = 7e-09 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +2 Query: 5 KLEALLFIFMIFMAISLPPIYACAPCTQPHPPGH 106 K+ A+ FIFMIFMAISLPPIYAC PCTQPHPP H Sbjct: 5 KVAAMSFIFMIFMAISLPPIYACTPCTQPHPPSH 38 >gb|EOY24386.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein [Theobroma cacao] Length = 239 Score = 62.8 bits (151), Expect = 1e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 2 SKLEALLFIFMIFMAISLPPIYACAPCTQPHPP 100 S+ AL+FIF+IFM ISLPPIYAC PCTQPHPP Sbjct: 3 SQFTALIFIFLIFMLISLPPIYACVPCTQPHPP 35 >ref|XP_004151037.1| PREDICTED: uncharacterized protein LOC101220939 [Cucumis sativus] Length = 253 Score = 60.5 bits (145), Expect = 7e-07 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +2 Query: 2 SKLEALLFIFMIFMAISLPPIYACAPCTQPHPP 100 SK A+ FI IFMA+SLPPIYAC PCTQPHPP Sbjct: 4 SKASAMFFILSIFMALSLPPIYACTPCTQPHPP 36