BLASTX nr result
ID: Jatropha_contig00042998
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00042998 (836 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_004918550.1| hypothetical protein [Riemerella anatipestif... 59 2e-06 >ref|WP_004918550.1| hypothetical protein [Riemerella anatipestifer] gi|315022991|gb|EFT36010.1| hypothetical protein RAYM_09754 [Riemerella anatipestifer RA-YM] Length = 43 Score = 58.9 bits (141), Expect = 2e-06 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = +3 Query: 297 MGATLMLPCRVQDDGSMGCKLLMYGKKPSLVTAADGTVRI 416 MGA+L+ P RV+DDG MGCKLL+Y KP+LV A+GTVRI Sbjct: 1 MGASLIQPSRVKDDGPMGCKLLLYRDKPTLVRVAEGTVRI 40