BLASTX nr result
ID: Jatropha_contig00042902
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00042902 (638 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_016882461.1| hypothetical protein [Rhodococcus sp. DK17] 65 2e-08 ref|WP_016882455.1| 4-oxalocrotonate tautomerase [Rhodococcus sp... 65 2e-08 ref|WP_009475390.1| 4-oxalocrotonate tautomerase [Rhodococcus sp... 65 2e-08 ref|YP_702633.1| hypothetical protein RHA1_ro02670 [Rhodococcus ... 65 2e-08 ref|YP_702627.1| hypothetical protein RHA1_ro02664 [Rhodococcus ... 64 3e-08 ref|WP_005262689.1| 4-oxalocrotonate tautomerase [Rhodococcus op... 59 1e-06 >ref|WP_016882461.1| hypothetical protein [Rhodococcus sp. DK17] Length = 61 Score = 64.7 bits (156), Expect = 2e-08 Identities = 29/45 (64%), Positives = 31/45 (68%) Frame = +2 Query: 242 WEIQIDETPMDLWRPHGLVPTPPLLALANIWTKEKLSIPCDVAAS 376 WEI IDETPMDLWR GLVP PP + +W KE IP DVAAS Sbjct: 17 WEIHIDETPMDLWRTQGLVPPPPESDMEKLWAKENRPIPYDVAAS 61 >ref|WP_016882455.1| 4-oxalocrotonate tautomerase [Rhodococcus sp. DK17] Length = 146 Score = 64.7 bits (156), Expect = 2e-08 Identities = 29/45 (64%), Positives = 31/45 (68%) Frame = +2 Query: 242 WEIQIDETPMDLWRPHGLVPTPPLLALANIWTKEKLSIPCDVAAS 376 WEI IDETPMDLWR GLVP PP + +W KE IP DVAAS Sbjct: 102 WEIHIDETPMDLWRTQGLVPPPPESDMEKLWAKENRPIPYDVAAS 146 >ref|WP_009475390.1| 4-oxalocrotonate tautomerase [Rhodococcus sp. JVH1] gi|396932001|gb|EJI99170.1| tautomerase enzyme family protein [Rhodococcus sp. JVH1] Length = 146 Score = 64.7 bits (156), Expect = 2e-08 Identities = 29/45 (64%), Positives = 31/45 (68%) Frame = +2 Query: 242 WEIQIDETPMDLWRPHGLVPTPPLLALANIWTKEKLSIPCDVAAS 376 WEI IDETPMDLWR GLVP PP + +W KE IP DVAAS Sbjct: 102 WEIHIDETPMDLWRTQGLVPPPPESDMEKLWAKENRPIPYDVAAS 146 >ref|YP_702633.1| hypothetical protein RHA1_ro02670 [Rhodococcus jostii RHA1] gi|499914638|ref|WP_011595372.1| 4-oxalocrotonate tautomerase [Rhodococcus jostii] gi|110819191|gb|ABG94475.1| conserved hypothetical protein [Rhodococcus jostii RHA1] Length = 146 Score = 64.7 bits (156), Expect = 2e-08 Identities = 29/45 (64%), Positives = 31/45 (68%) Frame = +2 Query: 242 WEIQIDETPMDLWRPHGLVPTPPLLALANIWTKEKLSIPCDVAAS 376 WEI IDETPMDLWR GLVP PP + +W KE IP DVAAS Sbjct: 102 WEIHIDETPMDLWRTQGLVPPPPESDMEKLWAKENRPIPYDVAAS 146 >ref|YP_702627.1| hypothetical protein RHA1_ro02664 [Rhodococcus jostii RHA1] gi|499914632|ref|WP_011595366.1| hypothetical protein [Rhodococcus jostii] gi|110819185|gb|ABG94469.1| conserved hypothetical protein [Rhodococcus jostii RHA1] Length = 66 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/45 (64%), Positives = 31/45 (68%) Frame = +2 Query: 242 WEIQIDETPMDLWRPHGLVPTPPLLALANIWTKEKLSIPCDVAAS 376 WEI IDETPMDLWR GLVP PP + +W KE IP DVAAS Sbjct: 22 WEIYIDETPMDLWRTQGLVPPPPESDMEKLWAKENRPIPYDVAAS 66 >ref|WP_005262689.1| 4-oxalocrotonate tautomerase [Rhodococcus opacus] gi|414567497|gb|EKT78280.1| hypothetical protein WSS_A33375 [Rhodococcus opacus M213] Length = 146 Score = 58.9 bits (141), Expect = 1e-06 Identities = 23/45 (51%), Positives = 30/45 (66%) Frame = +2 Query: 242 WEIQIDETPMDLWRPHGLVPTPPLLALANIWTKEKLSIPCDVAAS 376 WE+ IDETP+DLWR GLVP PP + +W KE +P + +AS Sbjct: 102 WEVHIDETPVDLWRTQGLVPPPPFSDMEKLWAKENRPVPYEFSAS 146