BLASTX nr result
ID: Jatropha_contig00042826
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00042826 (881 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABE09160.1| conserved hypothetical protein [Escherichia coli ... 75 2e-11 ref|WP_000463755.1| hypothetical protein, partial [Escherichia c... 75 4e-11 ref|WP_001335071.1| hypothetical protein, partial [Escherichia c... 74 7e-11 gb|ABE05727.1| hypothetical protein UTI89_C0218 [Escherichia col... 74 7e-11 ref|WP_001322382.1| hypothetical protein [Enterobacteriaceae] gi... 74 7e-11 ref|WP_021558320.1| hypothetical protein, partial [Escherichia c... 74 9e-11 ref|WP_000611551.1| hypothetical protein, partial [Salmonella en... 74 9e-11 gb|AAX66568.1| ORF16-lacZ fusion protein [Salmonella enterica su... 74 9e-11 gb|AAX67927.1| ORF16-lacZ fusion protein [Salmonella enterica su... 74 9e-11 gb|AAX64154.1| ORF16-lacZ fusion protein [Salmonella enterica su... 72 3e-10 gb|AAA72562.1| ORF16-lacZ fusion protein, partial [synthetic con... 72 3e-10 ref|WP_001350098.1| hypothetical protein [Escherichia coli] gi|3... 72 3e-10 emb|CCI74526.1| unnamed protein product [Klebsiella pneumoniae] 72 3e-10 emb|CAJ55199.1| hypothetical protein LI1145 [Lawsonia intracellu... 71 6e-10 ref|WP_016240497.1| hypothetical protein [Escherichia coli] gi|5... 70 7e-10 ref|WP_021533520.1| hypothetical protein [Escherichia coli] gi|5... 70 1e-09 ref|WP_021538273.1| hypothetical protein [Escherichia coli] gi|5... 69 2e-09 ref|WP_005306967.1| hypothetical protein [Aeromonas hydrophila] ... 67 8e-09 gb|AAU91204.1| conserved hypothetical protein [Methylococcus cap... 62 2e-07 dbj|BAH75139.1| hypothetical protein [Desulfovibrio magneticus R... 62 3e-07 >gb|ABE09160.1| conserved hypothetical protein [Escherichia coli UTI89] gi|115513939|gb|ABJ02014.1| conserved hypothetical protein [Escherichia coli APEC O1] Length = 121 Score = 75.5 bits (184), Expect = 2e-11 Identities = 41/73 (56%), Positives = 47/73 (64%), Gaps = 2/73 (2%) Frame = +1 Query: 526 AERPGEQLEGNRRKET--GERVHMSPSHHGPYEHGYTRDTKVHTESSDPARAMQSQKAYR 699 A RPG Q RR +V M+ SHHGPY+ GYTR T HT+ SD ARA + K R Sbjct: 19 AVRPGTQ----RRLPVINWRKVGMTSSHHGPYDQGYTRATMAHTKRSDLARASEPHKVRR 74 Query: 700 NPDWSLQLDSMKS 738 +PDWSLQLDSMKS Sbjct: 75 SPDWSLQLDSMKS 87 >ref|WP_000463755.1| hypothetical protein, partial [Escherichia coli] Length = 99 Score = 74.7 bits (182), Expect = 4e-11 Identities = 35/54 (64%), Positives = 39/54 (72%) Frame = +1 Query: 577 ERVHMSPSHHGPYEHGYTRDTKVHTESSDPARAMQSQKAYRNPDWSLQLDSMKS 738 E V M+ SHHGPY+ GYTR T HT+ SD ARA K R+PDWSLQLDSMKS Sbjct: 12 EEVGMTSSHHGPYDQGYTRATMAHTKRSDLARASGPHKVRRSPDWSLQLDSMKS 65 >ref|WP_001335071.1| hypothetical protein, partial [Escherichia coli] gi|300309108|gb|EFJ63628.1| hypothetical protein HMPREF9553_00243, partial [Escherichia coli MS 200-1] gi|412971811|emb|CCJ46477.1| putative uncharacterized protein, partial [Escherichia coli] Length = 133 Score = 73.9 bits (180), Expect = 7e-11 Identities = 41/73 (56%), Positives = 46/73 (63%), Gaps = 2/73 (2%) Frame = +1 Query: 526 AERPGEQLEGNRRKET--GERVHMSPSHHGPYEHGYTRDTKVHTESSDPARAMQSQKAYR 699 A RPG Q RR +V M+ SHHGPY+ GYTR T HT+ SD ARA K R Sbjct: 31 AVRPGTQ----RRLPVINWRKVGMTSSHHGPYDQGYTRATMAHTKRSDLARASGPHKVRR 86 Query: 700 NPDWSLQLDSMKS 738 +PDWSLQLDSMKS Sbjct: 87 SPDWSLQLDSMKS 99 >gb|ABE05727.1| hypothetical protein UTI89_C0218 [Escherichia coli UTI89] gi|91074857|gb|ABE09738.1| hypothetical protein UTI89_C4312 [Escherichia coli UTI89] gi|91074972|gb|ABE09853.1| hypothetical protein UTI89_C4437 [Escherichia coli UTI89] gi|91075094|gb|ABE09975.1| hypothetical protein UTI89_C4564 [Escherichia coli UTI89] Length = 106 Score = 73.9 bits (180), Expect = 7e-11 Identities = 41/73 (56%), Positives = 46/73 (63%), Gaps = 2/73 (2%) Frame = +1 Query: 526 AERPGEQLEGNRRKET--GERVHMSPSHHGPYEHGYTRDTKVHTESSDPARAMQSQKAYR 699 A RPG Q RR +V M+ SHHGPY+ GYTR T HT+ SD ARA K R Sbjct: 4 AVRPGTQ----RRLPVINWRKVGMTSSHHGPYDQGYTRATMAHTKRSDLARASGPHKVRR 59 Query: 700 NPDWSLQLDSMKS 738 +PDWSLQLDSMKS Sbjct: 60 SPDWSLQLDSMKS 72 >ref|WP_001322382.1| hypothetical protein [Enterobacteriaceae] gi|91073498|gb|ABE08379.1| hypothetical protein UTI89_C2923 [Escherichia coli UTI89] gi|91074360|gb|ABE09241.1| hypothetical protein UTI89_C3812 [Escherichia coli UTI89] gi|115511610|gb|ABI99684.1| conserved hypothetical protein [Escherichia coli APEC O1] gi|115514686|gb|ABJ02761.1| conserved hypothetical protein [Escherichia coli APEC O1] gi|115515151|gb|ABJ03226.1| conserved hypothetical protein [Escherichia coli APEC O1] gi|115515253|gb|ABJ03328.1| conserved hypothetical protein [Escherichia coli APEC O1] gi|115515394|gb|ABJ03469.1| conserved hypothetical protein [Escherichia coli APEC O1] gi|300360306|gb|EFJ76176.1| hypothetical protein HMPREF9552_00144 [Escherichia coli MS 198-1] gi|300421792|gb|EFK05103.1| hypothetical protein HMPREF9548_00105 [Escherichia coli MS 182-1] gi|300453575|gb|EFK17195.1| hypothetical protein HMPREF9541_00399 [Escherichia coli MS 116-1] gi|300463878|gb|EFK27371.1| hypothetical protein HMPREF9550_00464 [Escherichia coli MS 187-1] gi|300846578|gb|EFK74338.1| hypothetical protein HMPREF9535_01697 [Escherichia coli MS 78-1] gi|301077812|gb|EFK92618.1| hypothetical protein HMPREF9543_00498 [Escherichia coli MS 146-1] gi|332105325|gb|EGJ08671.1| hypothetical protein SSJG_04722 [Shigella sp. D9] Length = 121 Score = 73.9 bits (180), Expect = 7e-11 Identities = 41/73 (56%), Positives = 46/73 (63%), Gaps = 2/73 (2%) Frame = +1 Query: 526 AERPGEQLEGNRRKET--GERVHMSPSHHGPYEHGYTRDTKVHTESSDPARAMQSQKAYR 699 A RPG Q RR +V M+ SHHGPY+ GYTR T HT+ SD ARA K R Sbjct: 19 AVRPGTQ----RRLPVINWRKVGMTSSHHGPYDQGYTRATMAHTKRSDLARASGPHKVRR 74 Query: 700 NPDWSLQLDSMKS 738 +PDWSLQLDSMKS Sbjct: 75 SPDWSLQLDSMKS 87 >ref|WP_021558320.1| hypothetical protein, partial [Escherichia coli] gi|535560788|gb|EQW98549.1| hypothetical protein G915_02059, partial [Escherichia coli UMEA 3140-1] Length = 85 Score = 73.6 bits (179), Expect = 9e-11 Identities = 33/50 (66%), Positives = 38/50 (76%) Frame = +1 Query: 589 MSPSHHGPYEHGYTRDTKVHTESSDPARAMQSQKAYRNPDWSLQLDSMKS 738 M+ SHHGPY+ GYTR T HT+ SD ARA + K R+PDWSLQLDSMKS Sbjct: 2 MTSSHHGPYDQGYTRATMAHTKRSDLARASEPHKVRRSPDWSLQLDSMKS 51 >ref|WP_000611551.1| hypothetical protein, partial [Salmonella enterica] Length = 88 Score = 73.6 bits (179), Expect = 9e-11 Identities = 34/53 (64%), Positives = 39/53 (73%) Frame = +1 Query: 580 RVHMSPSHHGPYEHGYTRDTKVHTESSDPARAMQSQKAYRNPDWSLQLDSMKS 738 +V M+ SHHGPY+ GYTR T HT+ SD ARA K R+PDWSLQLDSMKS Sbjct: 6 KVGMTSSHHGPYDQGYTRATMAHTKRSDLARASGPHKVRRSPDWSLQLDSMKS 58 >gb|AAX66568.1| ORF16-lacZ fusion protein [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] Length = 106 Score = 73.6 bits (179), Expect = 9e-11 Identities = 34/53 (64%), Positives = 39/53 (73%) Frame = +1 Query: 580 RVHMSPSHHGPYEHGYTRDTKVHTESSDPARAMQSQKAYRNPDWSLQLDSMKS 738 +V M+ SHHGPY+ GYTR T HT+ SD ARA K R+PDWSLQLDSMKS Sbjct: 6 KVGMTSSHHGPYDQGYTRATMAHTKRSDLARASGPHKVRRSPDWSLQLDSMKS 58 >gb|AAX67927.1| ORF16-lacZ fusion protein [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] Length = 106 Score = 73.6 bits (179), Expect = 9e-11 Identities = 34/53 (64%), Positives = 39/53 (73%) Frame = +1 Query: 580 RVHMSPSHHGPYEHGYTRDTKVHTESSDPARAMQSQKAYRNPDWSLQLDSMKS 738 +V M+ SHHGPY+ GYTR T HT+ SD ARA K R+PDWSLQLDSMKS Sbjct: 20 KVGMTSSHHGPYDQGYTRATMAHTKRSDLARASGPHKVRRSPDWSLQLDSMKS 72 >gb|AAX64154.1| ORF16-lacZ fusion protein [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] gi|62130005|gb|AAX67708.1| ORF16-lacZ fusion protein [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] gi|62130087|gb|AAX67790.1| ORF16-lacZ fusion protein [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] Length = 106 Score = 72.0 bits (175), Expect = 3e-10 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = +1 Query: 580 RVHMSPSHHGPYEHGYTRDTKVHTESSDPARAMQSQKAYRNPDWSLQLDSMK 735 +V M+ SHHGPY+ GYTR T HT+ SD ARA K R+PDWSLQLDSMK Sbjct: 20 KVGMTSSHHGPYDQGYTRATMAHTKRSDLARASGPHKVRRSPDWSLQLDSMK 71 >gb|AAA72562.1| ORF16-lacZ fusion protein, partial [synthetic construct] Length = 68 Score = 72.0 bits (175), Expect = 3e-10 Identities = 33/50 (66%), Positives = 37/50 (74%) Frame = +1 Query: 589 MSPSHHGPYEHGYTRDTKVHTESSDPARAMQSQKAYRNPDWSLQLDSMKS 738 M+ SHHGPY+ GYTR T HT+ SD ARA K R+PDWSLQLDSMKS Sbjct: 1 MTSSHHGPYDQGYTRATMAHTKRSDLARASGPHKVRRSPDWSLQLDSMKS 50 >ref|WP_001350098.1| hypothetical protein [Escherichia coli] gi|306905123|gb|EFN35704.1| conserved hypothetical protein [Escherichia coli W] gi|431012173|gb|ELD26235.1| hypothetical protein A15U_00012 [Escherichia coli KTE210] gi|431012847|gb|ELD26605.1| hypothetical protein A15Y_04322 [Escherichia coli KTE212] gi|431025647|gb|ELD38745.1| hypothetical protein A177_04443 [Escherichia coli KTE216] gi|431070202|gb|ELD78508.1| hypothetical protein A197_04280 [Escherichia coli KTE236] gi|431088056|gb|ELD93961.1| hypothetical protein A1S7_04800 [Escherichia coli KTE49] gi|431088231|gb|ELD94127.1| hypothetical protein A1S7_04688 [Escherichia coli KTE49] gi|431342227|gb|ELG29206.1| hypothetical protein A1US_00630 [Escherichia coli KTE78] gi|431484821|gb|ELH64492.1| hypothetical protein A15E_00039 [Escherichia coli KTE202] gi|431500506|gb|ELH79520.1| hypothetical protein A15W_00001 [Escherichia coli KTE211] gi|431630180|gb|ELI98519.1| hypothetical protein WKA_04001 [Escherichia coli KTE153] gi|431731198|gb|ELJ94707.1| hypothetical protein WI3_04088 [Escherichia coli KTE99] gi|508519246|gb|EOW87919.1| hypothetical protein WAS_05016 [Escherichia coli KTE1] gi|534865076|gb|EQQ15598.1| hypothetical protein G753_04055 [Escherichia coli HVH 91 (4-4638751)] gi|534946374|gb|EQQ95322.1| hypothetical protein G777_05062 [Escherichia coli HVH 115 (4-4465989)] gi|534954580|gb|EQR03322.1| hypothetical protein G778_04084 [Escherichia coli HVH 116 (4-6879942)] gi|535053319|gb|EQS00220.1| hypothetical protein G799_04040 [Escherichia coli HVH 141 (4-5995973)] gi|535088181|gb|EQS34605.1| hypothetical protein G807_04003 [Escherichia coli HVH 149 (4-4451880)] gi|535325848|gb|EQU68590.1| hypothetical protein G864_04096 [Escherichia coli HVH 212 (3-9305343)] gi|535353788|gb|EQU96182.1| hypothetical protein G870_04222 [Escherichia coli HVH 218 (4-4500903)] gi|535358075|gb|EQV00420.1| hypothetical protein G870_02726 [Escherichia coli HVH 218 (4-4500903)] gi|535447532|gb|EQV87834.1| hypothetical protein G890_03005 [Escherichia coli KOEGE 62 (175a)] gi|535591867|gb|EQX29133.1| hypothetical protein G927_04012 [Escherichia coli UMEA 3172-1] gi|535614073|gb|EQX50896.1| hypothetical protein G931_04107 [Escherichia coli UMEA 3176-1] gi|535623692|gb|EQX60384.1| hypothetical protein G929_00204 [Escherichia coli UMEA 3174-1] gi|535679397|gb|EQY14885.1| hypothetical protein G944_02738 [Escherichia coli UMEA 3215-1] gi|535774150|gb|EQZ07508.1| hypothetical protein G970_04170 [Escherichia coli UMEA 3341-1] gi|535783121|gb|EQZ16358.1| hypothetical protein G970_00201 [Escherichia coli UMEA 3341-1] gi|535878699|gb|ERA10197.1| hypothetical protein G995_00202 [Escherichia coli UMEA 3805-1] gi|535908083|gb|ERA38961.1| hypothetical protein H001_00203 [Escherichia coli UMEA 3955-1] gi|535909366|gb|ERA40210.1| hypothetical protein H003_04574 [Escherichia coli UMEA 4076-1] gi|536000494|gb|ERA99969.1| hypothetical protein G879_04058 [Escherichia coli KOEGE 7 (16a)] gi|536031869|gb|ERB30751.1| hypothetical protein G960_04167 [Escherichia coli UMEA 3292-1] gi|556123345|gb|ESP11894.1| hypothetical protein G794_04312 [Escherichia coli HVH 136 (4-5970458)] gi|565502541|gb|ETF14463.1| hypothetical protein G831_03873 [Escherichia coli HVH 177 (4-2876612)] gi|565503007|gb|ETF14925.1| hypothetical protein G699_04632 [Escherichia coli HVH 23 (4-6066488)] Length = 84 Score = 72.0 bits (175), Expect = 3e-10 Identities = 33/50 (66%), Positives = 37/50 (74%) Frame = +1 Query: 589 MSPSHHGPYEHGYTRDTKVHTESSDPARAMQSQKAYRNPDWSLQLDSMKS 738 M+ SHHGPY+ GYTR T HT+ SD ARA K R+PDWSLQLDSMKS Sbjct: 1 MTSSHHGPYDQGYTRATMAHTKRSDLARASGPHKVRRSPDWSLQLDSMKS 50 >emb|CCI74526.1| unnamed protein product [Klebsiella pneumoniae] Length = 121 Score = 71.6 bits (174), Expect = 3e-10 Identities = 40/73 (54%), Positives = 46/73 (63%), Gaps = 2/73 (2%) Frame = +1 Query: 526 AERPGEQLEGNRRKET--GERVHMSPSHHGPYEHGYTRDTKVHTESSDPARAMQSQKAYR 699 A RPG Q RR +V M+ SHHGPY+ GYTR T +T+ SD ARA K R Sbjct: 19 AVRPGTQ----RRLPVINWRKVGMTSSHHGPYDQGYTRATMAYTKRSDLARASGPHKVCR 74 Query: 700 NPDWSLQLDSMKS 738 +PDWSLQLDSMKS Sbjct: 75 SPDWSLQLDSMKS 87 >emb|CAJ55199.1| hypothetical protein LI1145 [Lawsonia intracellularis PHE/MN1-00] Length = 106 Score = 70.9 bits (172), Expect = 6e-10 Identities = 33/47 (70%), Positives = 36/47 (76%) Frame = +1 Query: 598 SHHGPYEHGYTRDTKVHTESSDPARAMQSQKAYRNPDWSLQLDSMKS 738 SHHGPY GYTR T VHT+ S AR QSQK + +PDWSLQLDSMKS Sbjct: 6 SHHGPYAWGYTRTTMVHTKGSKTARWSQSQKMHLSPDWSLQLDSMKS 52 >ref|WP_016240497.1| hypothetical protein [Escherichia coli] gi|508384892|gb|EOV55944.1| hypothetical protein A1U9_04626 [Escherichia coli KTE68] Length = 84 Score = 70.5 bits (171), Expect = 7e-10 Identities = 32/50 (64%), Positives = 37/50 (74%) Frame = +1 Query: 589 MSPSHHGPYEHGYTRDTKVHTESSDPARAMQSQKAYRNPDWSLQLDSMKS 738 M+ SHHGPY+ GYTR T HT+ S+ ARA K R+PDWSLQLDSMKS Sbjct: 1 MTSSHHGPYDQGYTRATMAHTKRSELARASGPHKVRRSPDWSLQLDSMKS 50 >ref|WP_021533520.1| hypothetical protein [Escherichia coli] gi|535053104|gb|EQS00001.1| hypothetical protein G799_04268 [Escherichia coli HVH 141 (4-5995973)] gi|535088526|gb|EQS34914.1| hypothetical protein G804_02802 [Escherichia coli HVH 146 (4-3189767)] Length = 84 Score = 70.1 bits (170), Expect = 1e-09 Identities = 32/50 (64%), Positives = 37/50 (74%) Frame = +1 Query: 589 MSPSHHGPYEHGYTRDTKVHTESSDPARAMQSQKAYRNPDWSLQLDSMKS 738 M+ SHHGPY+ GYTR T HT+ S+ ARA K R+PDWSLQLDSMKS Sbjct: 1 MTSSHHGPYDQGYTRATMAHTKRSNLARASGPHKVRRSPDWSLQLDSMKS 50 >ref|WP_021538273.1| hypothetical protein [Escherichia coli] gi|535183759|gb|EQT28193.1| hypothetical protein G830_00217 [Escherichia coli HVH 176 (4-3428664)] Length = 84 Score = 68.9 bits (167), Expect = 2e-09 Identities = 32/50 (64%), Positives = 36/50 (72%) Frame = +1 Query: 589 MSPSHHGPYEHGYTRDTKVHTESSDPARAMQSQKAYRNPDWSLQLDSMKS 738 M+ SHHGPY+ GYTR T HT+ SD ARA K R+ DWSLQLDSMKS Sbjct: 1 MTSSHHGPYDQGYTRATMAHTKRSDLARASGPHKVRRSSDWSLQLDSMKS 50 >ref|WP_005306967.1| hypothetical protein [Aeromonas hydrophila] gi|404630053|gb|EKB26778.1| hypothetical protein HMPREF1171_03478 [Aeromonas hydrophila SSU] Length = 84 Score = 67.0 bits (162), Expect = 8e-09 Identities = 32/50 (64%), Positives = 35/50 (70%) Frame = +1 Query: 589 MSPSHHGPYEHGYTRDTKVHTESSDPARAMQSQKAYRNPDWSLQLDSMKS 738 M+ SHHGPY GYTR T TE A +SQKA R+PDWSLQLDSMKS Sbjct: 1 MTSSHHGPYGQGYTRATMARTEGCKLAIVSESQKARRSPDWSLQLDSMKS 50 >gb|AAU91204.1| conserved hypothetical protein [Methylococcus capsulatus str. Bath] gi|53758694|gb|AAU92985.1| conserved hypothetical protein [Methylococcus capsulatus str. Bath] Length = 84 Score = 62.4 bits (150), Expect = 2e-07 Identities = 32/50 (64%), Positives = 34/50 (68%) Frame = +1 Query: 589 MSPSHHGPYEHGYTRDTKVHTESSDPARAMQSQKAYRNPDWSLQLDSMKS 738 M+ SHHGPY GYTR T TE S AR QSQKA +PD SLQLD MKS Sbjct: 1 MTSSHHGPYGQGYTRATMAGTEGSQAARWSQSQKAGLSPDCSLQLDCMKS 50 >dbj|BAH75139.1| hypothetical protein [Desulfovibrio magneticus RS-1] Length = 123 Score = 62.0 bits (149), Expect = 3e-07 Identities = 30/58 (51%), Positives = 37/58 (63%) Frame = +1 Query: 565 KETGERVHMSPSHHGPYEHGYTRDTKVHTESSDPARAMQSQKAYRNPDWSLQLDSMKS 738 + TG +V + SHHGPY GYTR T V T + AR QSQK + +PD LQLD +KS Sbjct: 10 RSTGRKVGTTSSHHGPYAQGYTRTTMVGTMGCETARWSQSQKTHPSPDRGLQLDPVKS 67