BLASTX nr result
ID: Jatropha_contig00042821
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00042821 (770 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_007053129.1| conserved hypothetical protein [Bifidobacter... 70 7e-10 ref|WP_001029541.1| hypothetical protein [Bacteria] gi|227350652... 49 3e-07 ref|YP_006504677.1| hypothetical protein LPO_0642 [Legionella pn... 58 4e-06 >ref|WP_007053129.1| conserved hypothetical protein [Bifidobacterium longum] gi|239516221|gb|EEQ56088.1| hypothetical protein BLIG_02218 [Bifidobacterium longum subsp. infantis CCUG 52486] Length = 94 Score = 70.1 bits (170), Expect = 7e-10 Identities = 36/74 (48%), Positives = 46/74 (62%), Gaps = 1/74 (1%) Frame = -3 Query: 291 LRPYSPGGRLKV*SPEATP-QGHNLQVDIVAAWPTRVSNPVCSPCFRTYSSVFVQGAALA 115 +RPYSPGG L +P P G ++Q AW TRVSNPV SP FR+ +SV Q A A Sbjct: 1 MRPYSPGGMLNALAPTRNPWNGPHIQHPPFTAWTTRVSNPVRSPRFRSSASVTAQRPAFA 60 Query: 114 SGITPDLHASHRHT 73 G+ PD++ HR+T Sbjct: 61 IGVLPDIYTFHRYT 74 >ref|WP_001029541.1| hypothetical protein [Bacteria] gi|227350652|gb|EEJ40943.1| hypothetical protein HMPREF0549_0610 [Lactobacillus vaginalis ATCC 49540] gi|330861642|emb|CBX71821.1| hypothetical protein YEW_IW38370 [Yersinia enterocolitica W22703] Length = 47 Score = 49.3 bits (116), Expect(2) = 3e-07 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = +2 Query: 116 AKAAPWTKTEL*VRKQGEHTGLDTLVGHA 202 AKAAPWTKT+ VRK+GE TGLDTLV HA Sbjct: 2 AKAAPWTKTDAQVRKRGEQTGLDTLVVHA 30 Score = 32.3 bits (72), Expect(2) = 3e-07 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = +1 Query: 205 DDVDLEVVPLRRGFR 249 +DVDLEVVPLRRGFR Sbjct: 32 NDVDLEVVPLRRGFR 46 >ref|YP_006504677.1| hypothetical protein LPO_0642 [Legionella pneumophila subsp. pneumophila] gi|397665344|ref|YP_006506882.1| hypothetical protein LPO_3038 [Legionella pneumophila subsp. pneumophila] gi|397666245|ref|YP_006507782.1| hypothetical protein LPV_0677 [Legionella pneumophila subsp. pneumophila] gi|504653975|ref|WP_014841077.1| hypothetical protein [Legionella pneumophila] gi|395126550|emb|CCD04733.1| protein of unknown function [Legionella pneumophila subsp. pneumophila] gi|395128755|emb|CCD06973.1| protein of unknown function [Legionella pneumophila subsp. pneumophila] gi|395129656|emb|CCD07889.1| protein of unknown function [Legionella pneumophila subsp. pneumophila] Length = 68 Score = 57.8 bits (138), Expect = 4e-06 Identities = 29/49 (59%), Positives = 33/49 (67%) Frame = -3 Query: 201 AWPTRVSNPVCSPCFRTYSSVFVQGAALASGITPDLHASHRHTCKCTPL 55 AW TRVSNPVCSP FR SV Q AA A+G+ DL+A HR+T T L Sbjct: 6 AWTTRVSNPVCSPRFRASVSVLGQVAAFATGVPSDLYAFHRYTGNSTTL 54