BLASTX nr result
ID: Jatropha_contig00042799
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00042799 (418 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004291886.1| PREDICTED: uncharacterized membrane protein ... 60 4e-07 ref|XP_002510361.1| conserved hypothetical protein [Ricinus comm... 59 5e-07 gb|EMJ23171.1| hypothetical protein PRUPE_ppa002747mg [Prunus pe... 58 1e-06 >ref|XP_004291886.1| PREDICTED: uncharacterized membrane protein At1g75140-like [Fragaria vesca subsp. vesca] Length = 620 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/46 (63%), Positives = 34/46 (73%) Frame = -2 Query: 318 PGPDLVDLIYGTFSEVKYRGSTLESTGFPKRRXNLFGNNQVMDDSN 181 P VD + T +E+K+RGS LESTGFPKRR +LF NNQ MDDSN Sbjct: 575 PRSSSVDPSFRTGTELKFRGSALESTGFPKRRESLFVNNQAMDDSN 620 >ref|XP_002510361.1| conserved hypothetical protein [Ricinus communis] gi|223551062|gb|EEF52548.1| conserved hypothetical protein [Ricinus communis] Length = 651 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/44 (65%), Positives = 33/44 (75%) Frame = -2 Query: 312 PDLVDLIYGTFSEVKYRGSTLESTGFPKRRXNLFGNNQVMDDSN 181 P VD Y SE+KYRG TLE TGFPKRR NL+ NNQV+DDS+ Sbjct: 608 PTSVDPNYRPSSELKYRGPTLEPTGFPKRRENLYVNNQVVDDSS 651 >gb|EMJ23171.1| hypothetical protein PRUPE_ppa002747mg [Prunus persica] Length = 638 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/46 (60%), Positives = 35/46 (76%) Frame = -2 Query: 318 PGPDLVDLIYGTFSEVKYRGSTLESTGFPKRRXNLFGNNQVMDDSN 181 P P VD + T SE+K+RGS L+S+GFPKRR +LF N QVMDDS+ Sbjct: 593 PRPSSVDPNFRTASELKFRGSGLDSSGFPKRRESLFVNTQVMDDSS 638