BLASTX nr result
ID: Jatropha_contig00042766
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00042766 (650 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517479.1| Protein C10orf22, putative [Ricinus communis... 67 6e-09 ref|XP_002282644.1| PREDICTED: 2-aminoethanethiol dioxygenase is... 58 2e-06 ref|XP_002282633.1| PREDICTED: 2-aminoethanethiol dioxygenase is... 58 2e-06 >ref|XP_002517479.1| Protein C10orf22, putative [Ricinus communis] gi|223543490|gb|EEF45021.1| Protein C10orf22, putative [Ricinus communis] Length = 288 Score = 66.6 bits (161), Expect = 6e-09 Identities = 31/46 (67%), Positives = 38/46 (82%), Gaps = 1/46 (2%) Frame = -2 Query: 469 FLFEN-EVDGVSVPDEERENYAWLQDRGRLPEEFVVVGELYRGPKI 335 F F N VDGVS+P+EERE YAWLQ+R + P++F +VGELYRGPKI Sbjct: 240 FPFANFSVDGVSLPEEEREGYAWLQERTKQPDDFKMVGELYRGPKI 285 >ref|XP_002282644.1| PREDICTED: 2-aminoethanethiol dioxygenase isoform 3 [Vitis vinifera] Length = 268 Score = 58.2 bits (139), Expect = 2e-06 Identities = 30/46 (65%), Positives = 35/46 (76%), Gaps = 1/46 (2%) Frame = -2 Query: 469 FLFEN-EVDGVSVPDEERENYAWLQDRGRLPEEFVVVGELYRGPKI 335 F F N VDGVSVP+EERE YAWLQ+R +L E+F VVG +Y GP I Sbjct: 221 FPFTNFSVDGVSVPEEEREGYAWLQEREKL-EDFAVVGAVYNGPMI 265 >ref|XP_002282633.1| PREDICTED: 2-aminoethanethiol dioxygenase isoform 2 [Vitis vinifera] gi|296082863|emb|CBI22164.3| unnamed protein product [Vitis vinifera] Length = 279 Score = 58.2 bits (139), Expect = 2e-06 Identities = 30/46 (65%), Positives = 35/46 (76%), Gaps = 1/46 (2%) Frame = -2 Query: 469 FLFEN-EVDGVSVPDEERENYAWLQDRGRLPEEFVVVGELYRGPKI 335 F F N VDGVSVP+EERE YAWLQ+R +L E+F VVG +Y GP I Sbjct: 232 FPFTNFSVDGVSVPEEEREGYAWLQEREKL-EDFAVVGAVYNGPMI 276