BLASTX nr result
ID: Jatropha_contig00042647
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00042647 (507 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530023.1| ATP binding protein, putative [Ricinus commu... 64 3e-08 >ref|XP_002530023.1| ATP binding protein, putative [Ricinus communis] gi|223530502|gb|EEF32385.1| ATP binding protein, putative [Ricinus communis] Length = 696 Score = 63.5 bits (153), Expect = 3e-08 Identities = 39/73 (53%), Positives = 51/73 (69%), Gaps = 4/73 (5%) Frame = +2 Query: 260 MGCVSSKRALSVASASPVIEFSYAPQLAAHDHS--CSSKYTSGSFHFEQKHNKKDKKDG- 430 MGCV+SKR++SVA+ + S +P L +D S SS+ SGSFHF+QK +KKD+KD Sbjct: 1 MGCVTSKRSVSVAAGAAAA--SSSPSLGFNDRSTAASSRQPSGSFHFDQK-SKKDRKDHS 57 Query: 431 -SRRRHGSCDLDD 466 SRRR SCDLD+ Sbjct: 58 FSRRRKESCDLDN 70