BLASTX nr result
ID: Jatropha_contig00042592
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00042592 (523 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERP48565.1| hypothetical protein POPTR_0021s01010g [Populus t... 65 7e-09 ref|XP_004158016.1| PREDICTED: uncharacterized protein LOC101226... 65 7e-09 ref|XP_004145105.1| PREDICTED: uncharacterized protein LOC101212... 65 7e-09 ref|XP_002317096.1| predicted protein [Populus trichocarpa] gi|5... 65 7e-09 gb|EOY28660.1| Tobamovirus multiplication 1 isoform 2, partial [... 65 1e-08 gb|EOY28659.1| Tobamovirus multiplication 1 isoform 1 [Theobroma... 65 1e-08 ref|XP_003635618.1| PREDICTED: uncharacterized protein LOC100853... 65 1e-08 emb|CBI18853.3| unnamed protein product [Vitis vinifera] 65 1e-08 emb|CBI32988.3| unnamed protein product [Vitis vinifera] 65 1e-08 ref|XP_002271487.1| PREDICTED: uncharacterized protein LOC100250... 65 1e-08 ref|XP_002518505.1| conserved hypothetical protein [Ricinus comm... 65 1e-08 ref|XP_002304922.1| predicted protein [Populus trichocarpa] gi|2... 65 1e-08 emb|CAN77918.1| hypothetical protein VITISV_027643 [Vitis vinifera] 65 1e-08 gb|EMJ12954.1| hypothetical protein PRUPE_ppa009482mg [Prunus pe... 64 2e-08 gb|ESR62291.1| hypothetical protein CICLE_v10016130mg [Citrus cl... 63 3e-08 ref|XP_006348100.1| PREDICTED: tobamovirus multiplication protei... 62 6e-08 ref|NP_001234306.1| tobamovirus multiplication 1 homolog 3 [Sola... 62 6e-08 dbj|BAM48561.1| tobamovirus multiplication 1 [Solanum habrochaites] 62 6e-08 dbj|BAM48560.1| tobamovirus multiplication 1 [Solanum habrochaites] 62 6e-08 dbj|BAM48559.1| tobamovirus multiplication 1 [Solanum habrochaites] 62 6e-08 >gb|ERP48565.1| hypothetical protein POPTR_0021s01010g [Populus trichocarpa] Length = 327 Score = 65.5 bits (158), Expect = 7e-09 Identities = 32/58 (55%), Positives = 40/58 (68%) Frame = +2 Query: 14 SCIRFLVIWRTIIFHAETLPY*V*GRREKLHEVGSVTAICFTCFLIRCFVVSLNMYSS 187 + + FLV + F + P GRR+KLHEVGSVTAICFTCFLIRCFVV L+ + + Sbjct: 222 AALSFLVYGGRLFFMLKRFPIESKGRRKKLHEVGSVTAICFTCFLIRCFVVLLSAFDA 279 >ref|XP_004158016.1| PREDICTED: uncharacterized protein LOC101226967 [Cucumis sativus] Length = 215 Score = 65.5 bits (158), Expect = 7e-09 Identities = 31/58 (53%), Positives = 40/58 (68%) Frame = +2 Query: 14 SCIRFLVIWRTIIFHAETLPY*V*GRREKLHEVGSVTAICFTCFLIRCFVVSLNMYSS 187 + + FL+ + F P GRR+KLHEVGSVTAICFTCFLIRCFVV+L+ + + Sbjct: 110 AALGFLIYGGRLFFMLRRFPIESKGRRKKLHEVGSVTAICFTCFLIRCFVVALSAFDA 167 >ref|XP_004145105.1| PREDICTED: uncharacterized protein LOC101212327 [Cucumis sativus] gi|449471719|ref|XP_004153389.1| PREDICTED: uncharacterized protein LOC101221964 [Cucumis sativus] Length = 289 Score = 65.5 bits (158), Expect = 7e-09 Identities = 31/58 (53%), Positives = 40/58 (68%) Frame = +2 Query: 14 SCIRFLVIWRTIIFHAETLPY*V*GRREKLHEVGSVTAICFTCFLIRCFVVSLNMYSS 187 + + FL+ + F P GRR+KLHEVGSVTAICFTCFLIRCFVV+L+ + + Sbjct: 184 AALGFLIYGGRLFFMLRRFPIESKGRRKKLHEVGSVTAICFTCFLIRCFVVALSAFDA 241 >ref|XP_002317096.1| predicted protein [Populus trichocarpa] gi|550312481|gb|ERP48566.1| TOBAMOVIRUS MULTIPLICATION 1 family protein [Populus trichocarpa] Length = 244 Score = 65.5 bits (158), Expect = 7e-09 Identities = 32/58 (55%), Positives = 40/58 (68%) Frame = +2 Query: 14 SCIRFLVIWRTIIFHAETLPY*V*GRREKLHEVGSVTAICFTCFLIRCFVVSLNMYSS 187 + + FLV + F + P GRR+KLHEVGSVTAICFTCFLIRCFVV L+ + + Sbjct: 139 AALSFLVYGGRLFFMLKRFPIESKGRRKKLHEVGSVTAICFTCFLIRCFVVLLSAFDA 196 >gb|EOY28660.1| Tobamovirus multiplication 1 isoform 2, partial [Theobroma cacao] Length = 284 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/58 (55%), Positives = 39/58 (67%) Frame = +2 Query: 14 SCIRFLVIWRTIIFHAETLPY*V*GRREKLHEVGSVTAICFTCFLIRCFVVSLNMYSS 187 + + FL+ + F P GRR+KLHEVGSVTAICFTCFLIRCFVV L+ + S Sbjct: 186 AALGFLLYGGRLFFMLRRFPIESKGRRKKLHEVGSVTAICFTCFLIRCFVVVLSAFDS 243 >gb|EOY28659.1| Tobamovirus multiplication 1 isoform 1 [Theobroma cacao] Length = 291 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/58 (55%), Positives = 39/58 (67%) Frame = +2 Query: 14 SCIRFLVIWRTIIFHAETLPY*V*GRREKLHEVGSVTAICFTCFLIRCFVVSLNMYSS 187 + + FL+ + F P GRR+KLHEVGSVTAICFTCFLIRCFVV L+ + S Sbjct: 186 AALGFLLYGGRLFFMLRRFPIESKGRRKKLHEVGSVTAICFTCFLIRCFVVVLSAFDS 243 >ref|XP_003635618.1| PREDICTED: uncharacterized protein LOC100853906, partial [Vitis vinifera] Length = 149 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/58 (55%), Positives = 39/58 (67%) Frame = +2 Query: 14 SCIRFLVIWRTIIFHAETLPY*V*GRREKLHEVGSVTAICFTCFLIRCFVVSLNMYSS 187 + + FL+ + F P GRR+KLHEVGSVTAICFTCFLIRCFVV L+ + S Sbjct: 44 AALGFLLYGGRLFFMLRRFPIESKGRRKKLHEVGSVTAICFTCFLIRCFVVVLSAFDS 101 >emb|CBI18853.3| unnamed protein product [Vitis vinifera] Length = 166 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/58 (55%), Positives = 39/58 (67%) Frame = +2 Query: 14 SCIRFLVIWRTIIFHAETLPY*V*GRREKLHEVGSVTAICFTCFLIRCFVVSLNMYSS 187 + + FL+ + F P GRR+KLHEVGSVTAICFTCFLIRCFVV L+ + S Sbjct: 61 AALGFLLYGGRLFFMLRRFPIESKGRRKKLHEVGSVTAICFTCFLIRCFVVVLSAFDS 118 >emb|CBI32988.3| unnamed protein product [Vitis vinifera] Length = 289 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/58 (55%), Positives = 39/58 (67%) Frame = +2 Query: 14 SCIRFLVIWRTIIFHAETLPY*V*GRREKLHEVGSVTAICFTCFLIRCFVVSLNMYSS 187 + + FL+ + F P GRR+KLHEVGSVTAICFTCFLIRCFVV L+ + S Sbjct: 184 AALGFLLYGGRLFFMLRRFPIESKGRRKKLHEVGSVTAICFTCFLIRCFVVVLSAFDS 241 >ref|XP_002271487.1| PREDICTED: uncharacterized protein LOC100250291 [Vitis vinifera] Length = 289 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/58 (55%), Positives = 39/58 (67%) Frame = +2 Query: 14 SCIRFLVIWRTIIFHAETLPY*V*GRREKLHEVGSVTAICFTCFLIRCFVVSLNMYSS 187 + + FL+ + F P GRR+KLHEVGSVTAICFTCFLIRCFVV L+ + S Sbjct: 184 AALGFLLYGGRLFFMLRRFPIESKGRRKKLHEVGSVTAICFTCFLIRCFVVVLSAFDS 241 >ref|XP_002518505.1| conserved hypothetical protein [Ricinus communis] gi|223542350|gb|EEF43892.1| conserved hypothetical protein [Ricinus communis] Length = 260 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/58 (55%), Positives = 39/58 (67%) Frame = +2 Query: 14 SCIRFLVIWRTIIFHAETLPY*V*GRREKLHEVGSVTAICFTCFLIRCFVVSLNMYSS 187 + + FL+ + F P GRR+KLHEVGSVTAICFTCFLIRCFVV L+ + S Sbjct: 155 AALGFLLYGGRLFFMLRRFPIESKGRRKKLHEVGSVTAICFTCFLIRCFVVLLSAFDS 212 >ref|XP_002304922.1| predicted protein [Populus trichocarpa] gi|222847886|gb|EEE85433.1| TOBAMOVIRUS MULTIPLICATION 1 family protein [Populus trichocarpa] Length = 291 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/58 (55%), Positives = 39/58 (67%) Frame = +2 Query: 14 SCIRFLVIWRTIIFHAETLPY*V*GRREKLHEVGSVTAICFTCFLIRCFVVSLNMYSS 187 + + FLV + F P GRR+KLHEVGSVTAICFTCFLIRCFVV L+ + + Sbjct: 186 AALGFLVYGGRLFFMLRRFPIESKGRRKKLHEVGSVTAICFTCFLIRCFVVFLSAFDA 243 >emb|CAN77918.1| hypothetical protein VITISV_027643 [Vitis vinifera] Length = 265 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/58 (55%), Positives = 39/58 (67%) Frame = +2 Query: 14 SCIRFLVIWRTIIFHAETLPY*V*GRREKLHEVGSVTAICFTCFLIRCFVVSLNMYSS 187 + + FL+ + F P GRR+KLHEVGSVTAICFTCFLIRCFVV L+ + S Sbjct: 160 AALGFLLYGGRLFFMLRRFPIESKGRRKKLHEVGSVTAICFTCFLIRCFVVVLSAFDS 217 >gb|EMJ12954.1| hypothetical protein PRUPE_ppa009482mg [Prunus persica] Length = 290 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/58 (51%), Positives = 39/58 (67%) Frame = +2 Query: 14 SCIRFLVIWRTIIFHAETLPY*V*GRREKLHEVGSVTAICFTCFLIRCFVVSLNMYSS 187 + + FL+ + F P GRR+KLHEVGSVTAICFTCFL+RCFVV L+ + + Sbjct: 185 AALGFLIYGGRLFFMLRRFPIESKGRRKKLHEVGSVTAICFTCFLVRCFVVVLSAFDT 242 >gb|ESR62291.1| hypothetical protein CICLE_v10016130mg [Citrus clementina] Length = 291 Score = 63.2 bits (152), Expect = 3e-08 Identities = 31/56 (55%), Positives = 38/56 (67%) Frame = +2 Query: 14 SCIRFLVIWRTIIFHAETLPY*V*GRREKLHEVGSVTAICFTCFLIRCFVVSLNMY 181 + + FL+ + F P GRR+KLHEVGSVTAICFTCFLIRCFVV L+ + Sbjct: 186 AALGFLLYGGRLFFMLRRFPIESKGRRKKLHEVGSVTAICFTCFLIRCFVVVLSAF 241 >ref|XP_006348100.1| PREDICTED: tobamovirus multiplication protein 1-like [Solanum tuberosum] Length = 288 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +2 Query: 86 GRREKLHEVGSVTAICFTCFLIRCFVVSLNMYSS 187 GRR+KLHEVGSVTAICFTCFLIRCFVV L+ + S Sbjct: 207 GRRKKLHEVGSVTAICFTCFLIRCFVVVLSAFDS 240 >ref|NP_001234306.1| tobamovirus multiplication 1 homolog 3 [Solanum lycopersicum] gi|74038613|dbj|BAE43840.1| tobamovirus multiplication 1 homolog 3 [Solanum lycopersicum] Length = 288 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +2 Query: 86 GRREKLHEVGSVTAICFTCFLIRCFVVSLNMYSS 187 GRR+KLHEVGSVTAICFTCFLIRCFVV L+ + S Sbjct: 207 GRRKKLHEVGSVTAICFTCFLIRCFVVVLSAFDS 240 >dbj|BAM48561.1| tobamovirus multiplication 1 [Solanum habrochaites] Length = 288 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +2 Query: 86 GRREKLHEVGSVTAICFTCFLIRCFVVSLNMYSS 187 GRR+KLHEVGSVTAICFTCFLIRCFVV L+ + S Sbjct: 207 GRRKKLHEVGSVTAICFTCFLIRCFVVVLSAFDS 240 >dbj|BAM48560.1| tobamovirus multiplication 1 [Solanum habrochaites] Length = 288 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +2 Query: 86 GRREKLHEVGSVTAICFTCFLIRCFVVSLNMYSS 187 GRR+KLHEVGSVTAICFTCFLIRCFVV L+ + S Sbjct: 207 GRRKKLHEVGSVTAICFTCFLIRCFVVVLSAFDS 240 >dbj|BAM48559.1| tobamovirus multiplication 1 [Solanum habrochaites] Length = 288 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +2 Query: 86 GRREKLHEVGSVTAICFTCFLIRCFVVSLNMYSS 187 GRR+KLHEVGSVTAICFTCFLIRCFVV L+ + S Sbjct: 207 GRRKKLHEVGSVTAICFTCFLIRCFVVVLSAFDS 240