BLASTX nr result
ID: Jatropha_contig00042519
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00042519 (641 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADJ67188.1| hypothetical protein [Jatropha curcas] 113 1e-23 >gb|ADJ67188.1| hypothetical protein [Jatropha curcas] Length = 81 Score = 113 bits (283), Expect(2) = 1e-23 Identities = 58/72 (80%), Positives = 59/72 (81%) Frame = -3 Query: 618 LKEKEVQNYLCEMNTNRKYKIKKEKLDMRDFKGXXXXXXXXXIHPTKDSISNHNFLLNLT 439 L+ K NYLCEMNTNRKYKIKKEKLDMRDFKG IHPTKDSISNHNFLLNLT Sbjct: 10 LERKRGSNYLCEMNTNRKYKIKKEKLDMRDFKGNKIILNILKIHPTKDSISNHNFLLNLT 69 Query: 438 LKAFSSLLKASI 403 LKAFSSLLKASI Sbjct: 70 LKAFSSLLKASI 81 Score = 22.7 bits (47), Expect(2) = 1e-23 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = -2 Query: 631 FFLPLERKRGS 599 + LPLERKRGS Sbjct: 6 YVLPLERKRGS 16