BLASTX nr result
ID: Jatropha_contig00042513
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00042513 (664 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534410.1| conserved hypothetical protein [Ricinus comm... 64 5e-08 >ref|XP_002534410.1| conserved hypothetical protein [Ricinus communis] gi|223525350|gb|EEF27973.1| conserved hypothetical protein [Ricinus communis] Length = 431 Score = 63.5 bits (153), Expect = 5e-08 Identities = 43/123 (34%), Positives = 61/123 (49%), Gaps = 1/123 (0%) Frame = +1 Query: 298 NPIPNPKPLENQFESVTLEESNSIIQNDEVSVQPLEESNGIIQNDEALAVPQQVPSLNGS 477 +P PNPKPLE QF SVT++ESN+I++ND+ NDE ++NGS Sbjct: 12 DPSPNPKPLETQFGSVTIQESNNIVENDDAG------------NDE--------EAVNGS 51 Query: 478 LDDHVNHEEER-IEXXXXXXXXXXXXXIVWRTNXXXXXXXXXXXXXXXYAGERGSSSATS 654 ++++ EE+ ++ + R N YAGERGSSSA+S Sbjct: 52 VNENGCREEDSDVQIQAQEDIIELEESGIRRNNSEVEVDLPSSPSSSGYAGERGSSSASS 111 Query: 655 ASR 663 ASR Sbjct: 112 ASR 114