BLASTX nr result
ID: Jatropha_contig00042483
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00042483 (399 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530426.1| SEC14 cytosolic factor, putative [Ricinus co... 57 3e-06 >ref|XP_002530426.1| SEC14 cytosolic factor, putative [Ricinus communis] gi|223530034|gb|EEF31957.1| SEC14 cytosolic factor, putative [Ricinus communis] Length = 336 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/31 (74%), Positives = 30/31 (96%) Frame = +2 Query: 305 MGIVPDEAINQFKELMDQVDEPLKRTYQNIH 397 MGIVP+EA+NQF+ELMDQV+E L++TYQN+H Sbjct: 1 MGIVPEEAVNQFRELMDQVEESLQKTYQNVH 31