BLASTX nr result
ID: Jatropha_contig00042473
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00042473 (360 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFZ62129.1| acyl-CoA binding protein 3B [Vernicia fordii] gi|... 84 2e-14 ref|XP_002510117.1| acyl-CoA-binding protein, acbp, putative [Ri... 59 8e-07 ref|XP_002517510.1| conserved hypothetical protein [Ricinus comm... 58 1e-06 >gb|AFZ62129.1| acyl-CoA binding protein 3B [Vernicia fordii] gi|428754010|gb|AFZ62130.1| acyl-CoA binding protein 3B [Vernicia fordii] Length = 375 Score = 84.0 bits (206), Expect = 2e-14 Identities = 44/56 (78%), Positives = 48/56 (85%) Frame = +2 Query: 179 MELLQELFVTAFVAVVCSFLIAKIVSIAMAGGDSSNASRLSKSQNDDQKITGDDGD 346 MELLQELFVTA AVVCSFLIAK+VS+AMAG DSS+ S+ SKSQN DQKIT DD D Sbjct: 1 MELLQELFVTAVFAVVCSFLIAKLVSMAMAGADSSHDSQFSKSQNVDQKITRDDDD 56 >ref|XP_002510117.1| acyl-CoA-binding protein, acbp, putative [Ricinus communis] gi|223550818|gb|EEF52304.1| acyl-CoA-binding protein, acbp, putative [Ricinus communis] Length = 343 Score = 58.5 bits (140), Expect = 8e-07 Identities = 33/54 (61%), Positives = 41/54 (75%), Gaps = 1/54 (1%) Frame = +2 Query: 179 MELLQELFVTAFVAVVCSFLIAKIVSIAMAG-GDSSNASRLSKSQNDDQKITGD 337 MELLQELFVT VA++ SFLIAK+VS+ AG DS+ S+L KSQN DQ+ T + Sbjct: 1 MELLQELFVTVIVALLFSFLIAKLVSLGGAGDADSNQNSQLLKSQNTDQENTNE 54 >ref|XP_002517510.1| conserved hypothetical protein [Ricinus communis] gi|223543521|gb|EEF45052.1| conserved hypothetical protein [Ricinus communis] Length = 184 Score = 57.8 bits (138), Expect = 1e-06 Identities = 33/54 (61%), Positives = 40/54 (74%), Gaps = 1/54 (1%) Frame = +2 Query: 179 MELLQELFVTAFVAVVCSFLIAKIVSIAMAG-GDSSNASRLSKSQNDDQKITGD 337 MELLQELFVT VAV+ SFL AK+VS+ AG DS+ S+L KSQN DQ+ T + Sbjct: 1 MELLQELFVTVIVAVLFSFLTAKLVSLGGAGDADSNQNSQLLKSQNTDQENTNE 54