BLASTX nr result
ID: Jatropha_contig00042422
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00042422 (520 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACT87979.1| zeta carotene desaturase [Jatropha curcas] 92 9e-21 ref|XP_002512239.1| Zeta-carotene desaturase, chloroplast precur... 60 3e-11 gb|ERP60564.1| hypothetical protein POPTR_0005s05230g [Populus t... 50 3e-08 >gb|ACT87979.1| zeta carotene desaturase [Jatropha curcas] Length = 586 Score = 92.4 bits (228), Expect(2) = 9e-21 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = +1 Query: 331 MASSILFPTNSITGTRSKNPGFLPSCGRRSVAQVVRTQRLSFVRAA 468 MASSILFPTNSITGTRSKNPGFLPSCGRRSVAQVVRTQRLSFVRAA Sbjct: 1 MASSILFPTNSITGTRSKNPGFLPSCGRRSVAQVVRTQRLSFVRAA 46 Score = 33.1 bits (74), Expect(2) = 9e-21 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +2 Query: 470 LDSLETKVSDMSVYAPK 520 LDSLETKVSDMSV APK Sbjct: 47 LDSLETKVSDMSVNAPK 63 >ref|XP_002512239.1| Zeta-carotene desaturase, chloroplast precursor, putative [Ricinus communis] gi|223548200|gb|EEF49691.1| Zeta-carotene desaturase, chloroplast precursor, putative [Ricinus communis] Length = 964 Score = 60.1 bits (144), Expect(2) = 3e-11 Identities = 33/48 (68%), Positives = 37/48 (77%), Gaps = 1/48 (2%) Frame = +1 Query: 328 VMASSILFPTNSITGTRSKNPGFLPSCGRR-SVAQVVRTQRLSFVRAA 468 +MASSIL P NS+ GTR + PGFL S RR S AQVVRTQRL FVR+A Sbjct: 1 MMASSILLPANSVAGTRRRTPGFLLSGDRRSSTAQVVRTQRLFFVRSA 48 Score = 33.1 bits (74), Expect(2) = 3e-11 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +2 Query: 470 LDSLETKVSDMSVYAPK 520 LDSLETKVSDMSV APK Sbjct: 49 LDSLETKVSDMSVNAPK 65 >gb|ERP60564.1| hypothetical protein POPTR_0005s05230g [Populus trichocarpa] Length = 589 Score = 50.1 bits (118), Expect(2) = 3e-08 Identities = 31/49 (63%), Positives = 36/49 (73%), Gaps = 3/49 (6%) Frame = +1 Query: 331 MASSILFPTNSITGTRSKN--PGFLPSCGRRSVAQV-VRTQRLSFVRAA 468 MAS IL P NS++GTRSK PGFL S GRR+VAQV R +RL VR+A Sbjct: 1 MASLILLPANSVSGTRSKTAPPGFLFSGGRRAVAQVGFRNRRLFTVRSA 49 Score = 33.1 bits (74), Expect(2) = 3e-08 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +2 Query: 470 LDSLETKVSDMSVYAPK 520 LDSLETKVSDMSV APK Sbjct: 50 LDSLETKVSDMSVNAPK 66