BLASTX nr result
ID: Jatropha_contig00042278
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00042278 (663 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522323.1| conserved hypothetical protein [Ricinus comm... 61 2e-07 >ref|XP_002522323.1| conserved hypothetical protein [Ricinus communis] gi|223538401|gb|EEF40007.1| conserved hypothetical protein [Ricinus communis] Length = 709 Score = 61.2 bits (147), Expect = 2e-07 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = +2 Query: 536 GDGLSSSNSPIASVFVGRDTRKMVEPLDIKSHGKVHPDFIVD 661 GDGLSSSNSP AS+ GR R+ V+PLDI+S KVHPDF VD Sbjct: 179 GDGLSSSNSPKASILAGRQGRRKVDPLDIRSPRKVHPDFSVD 220