BLASTX nr result
ID: Jatropha_contig00042237
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00042237 (533 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533586.1| conserved hypothetical protein [Ricinus comm... 67 6e-12 ref|XP_002313438.1| predicted protein [Populus trichocarpa] gi|2... 58 2e-07 >ref|XP_002533586.1| conserved hypothetical protein [Ricinus communis] gi|223526530|gb|EEF28791.1| conserved hypothetical protein [Ricinus communis] Length = 176 Score = 67.4 bits (163), Expect(2) = 6e-12 Identities = 34/50 (68%), Positives = 43/50 (86%) Frame = +1 Query: 271 MGVSNSEMLISEKDLNSMEFNFLVRPSLEFGEKCEIASSQDCINDDGNDL 420 MGVSNSEML+SEKDL+SMEFNFLVRP+L+F ++C+IA Q I+ D +DL Sbjct: 1 MGVSNSEMLLSEKDLSSMEFNFLVRPALKFEDECDIAPLQ--ISSDPDDL 48 Score = 28.5 bits (62), Expect(2) = 6e-12 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = +3 Query: 486 CKLLVSALKIELPSL 530 CKLL+S LKI+LPSL Sbjct: 65 CKLLISTLKIKLPSL 79 >ref|XP_002313438.1| predicted protein [Populus trichocarpa] gi|222849846|gb|EEE87393.1| hypothetical protein POPTR_0009s03550g [Populus trichocarpa] Length = 203 Score = 57.8 bits (138), Expect(2) = 2e-07 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = +1 Query: 271 MGVSNSEMLISEKDLNSMEFNFLVRPSLEFGEKCEI 378 MG SNSEM SEKDLN MEFNFLVR +LE G+ CEI Sbjct: 1 MGFSNSEMFFSEKDLNPMEFNFLVRSALELGDDCEI 36 Score = 23.1 bits (48), Expect(2) = 2e-07 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = +3 Query: 486 CKLLVSALKIELPSLE 533 C++ V LKI+LPS+E Sbjct: 58 CEISVPTLKIKLPSVE 73