BLASTX nr result
ID: Jatropha_contig00042019
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00042019 (480 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522798.1| conserved hypothetical protein [Ricinus comm... 59 2e-08 >ref|XP_002522798.1| conserved hypothetical protein [Ricinus communis] gi|223538036|gb|EEF39649.1| conserved hypothetical protein [Ricinus communis] Length = 651 Score = 58.5 bits (140), Expect(2) = 2e-08 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = +3 Query: 360 MELVPYGDPNSKPESPTLPWQDMFRSGSFRK 452 MELVPY DP SKPES TLPWQDMFRS SF K Sbjct: 1 MELVPYTDPKSKPESTTLPWQDMFRSASFNK 31 Score = 25.4 bits (54), Expect(2) = 2e-08 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = +1 Query: 445 FAKPTTTNPPKP 480 F KPTT++PPKP Sbjct: 29 FNKPTTSHPPKP 40