BLASTX nr result
ID: Jatropha_contig00041857
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00041857 (518 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510745.1| conserved hypothetical protein [Ricinus comm... 63 3e-08 >ref|XP_002510745.1| conserved hypothetical protein [Ricinus communis] gi|223551446|gb|EEF52932.1| conserved hypothetical protein [Ricinus communis] Length = 1553 Score = 63.2 bits (152), Expect = 3e-08 Identities = 33/53 (62%), Positives = 37/53 (69%), Gaps = 2/53 (3%) Frame = +3 Query: 342 NEDLPTAAAAAS--NGVEDGNENARGNGEDDSDASYVFVAGNDVGADEPAETA 494 + D PTA AA S NGV++ NEN +GN EDD DASYVFV GNDV AD P A Sbjct: 28 HRDPPTATAALSDINGVKEENENGKGNMEDDPDASYVFVGGNDVDADTPDRPA 80