BLASTX nr result
ID: Jatropha_contig00041759
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00041759 (617 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526344.1| hydrolase, putative [Ricinus communis] gi|22... 94 4e-17 >ref|XP_002526344.1| hydrolase, putative [Ricinus communis] gi|223534303|gb|EEF36015.1| hydrolase, putative [Ricinus communis] Length = 550 Score = 93.6 bits (231), Expect = 4e-17 Identities = 50/69 (72%), Positives = 54/69 (78%) Frame = +2 Query: 395 MDTDQDGYPTFAEGRETRYSSARTGNGVGKDYGGDHPEMGFQDQVREVLKGAGELSVQFA 574 MDTDQD YPTFAEGRETRYS A NG K Y + EMGFQDQV+E LKGA E+SVQ A Sbjct: 1 MDTDQDEYPTFAEGRETRYSHAT--NGARKGYVV-YQEMGFQDQVKEFLKGAAEMSVQCA 57 Query: 575 KGCRDVVVQ 601 KGCRD+VVQ Sbjct: 58 KGCRDIVVQ 66