BLASTX nr result
ID: Jatropha_contig00041728
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00041728 (728 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_007374883.1| hypothetical protein Pra_mt0305 (mitochondri... 71 4e-10 gb|ELU37844.1| hypothetical protein AG1IA_08121 [Rhizoctonia sol... 70 5e-10 >ref|YP_007374883.1| hypothetical protein Pra_mt0305 (mitochondrion) [Phlebia radiata] gi|441414400|emb|CCF07373.1| hypothetical protein Pra_mt0305 (mitochondrion) [Phlebia radiata] Length = 57 Score = 70.9 bits (172), Expect = 4e-10 Identities = 35/51 (68%), Positives = 37/51 (72%) Frame = +1 Query: 283 MDRTGECCITLRRVLESGEMPI*PRDSWFSTKHI*V*RLHKIYEGTECNSQ 435 MDRTGECCI LR VL SGE PI P DSWFSTKH+ V L+KIY GT Q Sbjct: 1 MDRTGECCIILRWVLRSGERPIWPSDSWFSTKHMIVWHLYKIYGGTALGLQ 51 >gb|ELU37844.1| hypothetical protein AG1IA_08121 [Rhizoctonia solani AG-1 IA] Length = 67 Score = 70.5 bits (171), Expect = 5e-10 Identities = 33/51 (64%), Positives = 40/51 (78%) Frame = -3 Query: 381 MFRRKPAITRSDWHFTAFQNSSESNATLTRSVHYNLVLERSPRFGSNRSNL 229 MFR AI+RS+W FT F +SSE+ AT RS+HYNL +ERSPRFGSN SN+ Sbjct: 1 MFRGISAISRSEWPFTPFHSSSENFATFIRSIHYNLAMERSPRFGSNISNI 51