BLASTX nr result
ID: Jatropha_contig00041537
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00041537 (635 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK96202.1| unknown [Populus trichocarpa] gi|550344446|gb|EEE... 64 4e-08 gb|ERP61416.1| hypothetical protein POPTR_0005s21300g [Populus t... 57 3e-06 gb|EEE94487.2| hypothetical protein POPTR_0005s21300g [Populus t... 57 3e-06 >gb|ABK96202.1| unknown [Populus trichocarpa] gi|550344446|gb|EEE80198.2| hypothetical protein POPTR_0002s07020g [Populus trichocarpa] Length = 340 Score = 63.5 bits (153), Expect = 4e-08 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +1 Query: 163 MDPSKFIGKQPMTMDIEQMPDIPQRGSHHRRAH 261 MDP+KF GKQPMT+DIEQMP+ P RGSHHRRAH Sbjct: 1 MDPTKFRGKQPMTVDIEQMPETPYRGSHHRRAH 33 >gb|ERP61416.1| hypothetical protein POPTR_0005s21300g [Populus trichocarpa] Length = 225 Score = 57.4 bits (137), Expect = 3e-06 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = +1 Query: 163 MDPSKFIGKQPMTMDIEQMPDIPQRGSHHRRAH 261 M+P+KF G+QPM +DIEQMP+ P RG+HHRRAH Sbjct: 1 MEPTKFRGEQPMIVDIEQMPETPHRGNHHRRAH 33 >gb|EEE94487.2| hypothetical protein POPTR_0005s21300g [Populus trichocarpa] Length = 321 Score = 57.4 bits (137), Expect = 3e-06 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = +1 Query: 163 MDPSKFIGKQPMTMDIEQMPDIPQRGSHHRRAH 261 M+P+KF G+QPM +DIEQMP+ P RG+HHRRAH Sbjct: 1 MEPTKFRGEQPMIVDIEQMPETPHRGNHHRRAH 33