BLASTX nr result
ID: Jatropha_contig00041265
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00041265 (361 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEE83113.2| hypothetical protein POPTR_0001s26000g [Populus t... 55 9e-06 ref|XP_002298308.1| predicted protein [Populus trichocarpa] 55 9e-06 >gb|EEE83113.2| hypothetical protein POPTR_0001s26000g [Populus trichocarpa] Length = 348 Score = 55.1 bits (131), Expect = 9e-06 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = +1 Query: 157 MGFSEDNLKGFILALSSSAFYRGKASLSRKKGLKRAAAVSWV 282 MGFS+DNLKGF+LALSSSAF G + + +KKGL+RAAA S V Sbjct: 1 MGFSQDNLKGFVLALSSSAFI-GASFIIKKKGLRRAAAASGV 41 >ref|XP_002298308.1| predicted protein [Populus trichocarpa] Length = 299 Score = 55.1 bits (131), Expect = 9e-06 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = +1 Query: 157 MGFSEDNLKGFILALSSSAFYRGKASLSRKKGLKRAAAVSWV 282 MGFS+DNLKGF+LALSSSAF G + + +KKGL+RAAA S V Sbjct: 1 MGFSQDNLKGFVLALSSSAFI-GASFIIKKKGLRRAAAASGV 41