BLASTX nr result
ID: Jatropha_contig00041258
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00041258 (344 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOX97619.1| PAM domain (PCI/PINT associated module) protein i... 54 2e-06 >gb|EOX97619.1| PAM domain (PCI/PINT associated module) protein isoform 1 [Theobroma cacao] gi|508705724|gb|EOX97620.1| PAM domain (PCI/PINT associated module) protein isoform 1 [Theobroma cacao] Length = 484 Score = 53.5 bits (127), Expect(2) = 2e-06 Identities = 28/43 (65%), Positives = 29/43 (67%) Frame = +2 Query: 122 MTQDVEMKEQXXXXXXXXXXXXXXLHHLKEIASLIETGAYARK 250 MTQDVEMKEQ LHHLKEIASLIETGAYAR+ Sbjct: 1 MTQDVEMKEQAAPSNSLSSSSPSTLHHLKEIASLIETGAYARE 43 Score = 23.5 bits (49), Expect(2) = 2e-06 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = +1 Query: 262 MVRAVPLTMALGKKLQGS 315 ++RAV LTMAL +KL+ S Sbjct: 47 ILRAVRLTMALRRKLKAS 64