BLASTX nr result
ID: Jatropha_contig00041191
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00041191 (465 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519116.1| conserved hypothetical protein [Ricinus comm... 52 3e-12 >ref|XP_002519116.1| conserved hypothetical protein [Ricinus communis] gi|223541779|gb|EEF43327.1| conserved hypothetical protein [Ricinus communis] Length = 513 Score = 51.6 bits (122), Expect(2) = 3e-12 Identities = 27/56 (48%), Positives = 35/56 (62%) Frame = +2 Query: 212 NEEMEPDREPNKRQKQPELEEQKQRFPSKSCIGRLHSRFTSGEITPGRFVDLDFFH 379 N+ +E DREP K +K + E F SK+C+ R HSRF GE PGR +DL FF+ Sbjct: 15 NDVVENDREPKKPRKWLQSGEISY-FSSKACMERYHSRFIYGETVPGRSIDLGFFN 69 Score = 45.4 bits (106), Expect(2) = 3e-12 Identities = 16/29 (55%), Positives = 23/29 (79%) Frame = +3 Query: 372 FFTREGFQFARWFKEMNWVSVMVMKQKIF 458 FF +EGFQ +WFK MNWVS +++K+K + Sbjct: 67 FFNQEGFQLGKWFKHMNWVSFILIKEKFY 95