BLASTX nr result
ID: Jatropha_contig00041173
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00041173 (292 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517867.1| conserved hypothetical protein [Ricinus comm... 61 1e-07 gb|ERP50537.1| reticulon family protein [Populus trichocarpa] 59 8e-07 gb|ERP50536.1| hypothetical protein POPTR_0017s04610g [Populus t... 59 8e-07 ref|XP_002328044.1| predicted protein [Populus trichocarpa] 59 8e-07 >ref|XP_002517867.1| conserved hypothetical protein [Ricinus communis] gi|223542849|gb|EEF44385.1| conserved hypothetical protein [Ricinus communis] Length = 444 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +2 Query: 197 MDSTPPSHKSNPNSQTKSASRLARITYSVENE 292 MDSTPPSH+SNPNSQTKSASRLARIT S++NE Sbjct: 1 MDSTPPSHRSNPNSQTKSASRLARITSSIDNE 32 >gb|ERP50537.1| reticulon family protein [Populus trichocarpa] Length = 439 Score = 58.5 bits (140), Expect = 8e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +2 Query: 197 MDSTPPSHKSNPNSQTKSASRLARITYSVENE 292 MD+TPPSH+SNPNSQ KSASRL+RITYS+E E Sbjct: 1 MDTTPPSHRSNPNSQAKSASRLSRITYSIEPE 32 >gb|ERP50536.1| hypothetical protein POPTR_0017s04610g [Populus trichocarpa] Length = 356 Score = 58.5 bits (140), Expect = 8e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +2 Query: 197 MDSTPPSHKSNPNSQTKSASRLARITYSVENE 292 MD+TPPSH+SNPNSQ KSASRL+RITYS+E E Sbjct: 1 MDTTPPSHRSNPNSQAKSASRLSRITYSIEPE 32 >ref|XP_002328044.1| predicted protein [Populus trichocarpa] Length = 404 Score = 58.5 bits (140), Expect = 8e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +2 Query: 197 MDSTPPSHKSNPNSQTKSASRLARITYSVENE 292 MD+TPPSH+SNPNSQ KSASRL+RITYS+E E Sbjct: 1 MDTTPPSHRSNPNSQAKSASRLSRITYSIEPE 32