BLASTX nr result
ID: Jatropha_contig00041102
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00041102 (293 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524779.1| sugar transporter, putative [Ricinus communi... 56 5e-06 >ref|XP_002524779.1| sugar transporter, putative [Ricinus communis] gi|223535963|gb|EEF37622.1| sugar transporter, putative [Ricinus communis] Length = 481 Score = 55.8 bits (133), Expect = 5e-06 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +1 Query: 181 AIKEEIENGNGKNGVHQEAREPLMRKNLADEENGSRE 291 AI+++I NG+G N V +E REPLM KNLADEENGSRE Sbjct: 2 AIQKDIGNGSGDNDVQEEVREPLMGKNLADEENGSRE 38