BLASTX nr result
ID: Jatropha_contig00041099
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00041099 (445 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529121.1| Dihydrolipoyllysine-residue acetyltransferas... 56 4e-06 >ref|XP_002529121.1| Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase, putative [Ricinus communis] gi|223531400|gb|EEF33234.1| Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase, putative [Ricinus communis] Length = 483 Score = 56.2 bits (134), Expect = 4e-06 Identities = 30/34 (88%), Positives = 31/34 (91%), Gaps = 2/34 (5%) Frame = +2 Query: 332 HRCN--RRNNALRVQSKIREIFMPALSSTMTEGK 427 HR N RR+NALRVQSKIREIFMPALSSTMTEGK Sbjct: 38 HRQNHARRSNALRVQSKIREIFMPALSSTMTEGK 71