BLASTX nr result
ID: Jatropha_contig00041019
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00041019 (468 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521713.1| dihydrodipicolinate synthase, putative [Rici... 56 4e-06 >ref|XP_002521713.1| dihydrodipicolinate synthase, putative [Ricinus communis] gi|223539104|gb|EEF40700.1| dihydrodipicolinate synthase, putative [Ricinus communis] Length = 367 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/49 (55%), Positives = 34/49 (69%), Gaps = 2/49 (4%) Frame = +3 Query: 324 MAALSGYGVCLKESALQL--PRSVSTNYYKRRNAKWKSPSSCYNSQFSI 464 M LS Y VCLK+SALQL P SVST++YKRR+ KW+SP + F + Sbjct: 1 MGILSSYSVCLKQSALQLQLPHSVSTDFYKRRSGKWRSPQAAVIPNFHL 49