BLASTX nr result
ID: Jatropha_contig00040928
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00040928 (583 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERP66435.1| hypothetical protein POPTR_0001s34310g [Populus t... 70 4e-10 ref|XP_002331876.1| predicted protein [Populus trichocarpa] 70 4e-10 ref|XP_002519755.1| hypothetical protein RCOM_0634810 [Ricinus c... 67 3e-09 gb|ESR62845.1| hypothetical protein CICLE_v10017480mg [Citrus cl... 66 5e-09 gb|ERP55049.1| hypothetical protein POPTR_0011s02960g [Populus t... 65 1e-08 ref|XP_002317308.1| predicted protein [Populus trichocarpa] 65 1e-08 gb|EOY27829.1| Uncharacterized protein isoform 5 [Theobroma cacao] 62 1e-07 gb|EOY27828.1| Uncharacterized protein isoform 4, partial [Theob... 62 1e-07 gb|EOY27825.1| Uncharacterized protein isoform 1 [Theobroma caca... 62 1e-07 >gb|ERP66435.1| hypothetical protein POPTR_0001s34310g [Populus trichocarpa] Length = 356 Score = 70.1 bits (170), Expect = 4e-10 Identities = 32/44 (72%), Positives = 34/44 (77%) Frame = +3 Query: 447 PQGNDDPKSQDERESDGGDTGSPKSQDQHNQQDSANEENDESVK 578 PQGNDDPKS DERESDGG+ G+P SQDQHN Q NE N ES K Sbjct: 32 PQGNDDPKSHDERESDGGEVGTPVSQDQHNHQHPFNEGNGESEK 75 >ref|XP_002331876.1| predicted protein [Populus trichocarpa] Length = 356 Score = 70.1 bits (170), Expect = 4e-10 Identities = 32/44 (72%), Positives = 34/44 (77%) Frame = +3 Query: 447 PQGNDDPKSQDERESDGGDTGSPKSQDQHNQQDSANEENDESVK 578 PQGNDDPKS DERESDGG+ G+P SQDQHN Q NE N ES K Sbjct: 32 PQGNDDPKSHDERESDGGEVGTPVSQDQHNHQHPFNEGNGESEK 75 >ref|XP_002519755.1| hypothetical protein RCOM_0634810 [Ricinus communis] gi|223541172|gb|EEF42728.1| hypothetical protein RCOM_0634810 [Ricinus communis] Length = 389 Score = 67.0 bits (162), Expect = 3e-09 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = +3 Query: 456 NDDPKSQDERESDGGDTGSPKSQDQHNQQDSANEENDESVKR 581 N+DPKSQDER+SDGG+ GSP SQD HNQ+ NE+N+ES KR Sbjct: 34 NNDPKSQDERDSDGGEVGSPASQDHHNQEHPFNEDNEESEKR 75 >gb|ESR62845.1| hypothetical protein CICLE_v10017480mg [Citrus clementina] Length = 333 Score = 66.2 bits (160), Expect = 5e-09 Identities = 31/45 (68%), Positives = 32/45 (71%) Frame = +3 Query: 447 PQGNDDPKSQDERESDGGDTGSPKSQDQHNQQDSANEENDESVKR 581 P GNDDPKSQDERESDGG+ GSP SQD HN Q E N E KR Sbjct: 33 PLGNDDPKSQDERESDGGEAGSPASQDHHNHQHPFQEGNGELEKR 77 >gb|ERP55049.1| hypothetical protein POPTR_0011s02960g [Populus trichocarpa] Length = 371 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/44 (70%), Positives = 32/44 (72%) Frame = +3 Query: 447 PQGNDDPKSQDERESDGGDTGSPKSQDQHNQQDSANEENDESVK 578 PQGN DPKS DERESDGG+ GSP S DQHN Q NE N ES K Sbjct: 30 PQGNGDPKSPDERESDGGEIGSPVSLDQHNHQHPFNEGNGESEK 73 >ref|XP_002317308.1| predicted protein [Populus trichocarpa] Length = 262 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/44 (70%), Positives = 32/44 (72%) Frame = +3 Query: 447 PQGNDDPKSQDERESDGGDTGSPKSQDQHNQQDSANEENDESVK 578 PQGN DPKS DERESDGG+ GSP S DQHN Q NE N ES K Sbjct: 30 PQGNGDPKSPDERESDGGEIGSPVSLDQHNHQHPFNEGNGESEK 73 >gb|EOY27829.1| Uncharacterized protein isoform 5 [Theobroma cacao] Length = 309 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = +3 Query: 447 PQGNDDPKSQDERESDGGDTGSPKSQDQHNQQDSANEENDE 569 P GNDDPKSQDER+SDGGD GSP SQD N Q++ ++ +E Sbjct: 30 PHGNDDPKSQDERDSDGGDVGSPASQDDQNHQNAFSQGREE 70 >gb|EOY27828.1| Uncharacterized protein isoform 4, partial [Theobroma cacao] Length = 309 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = +3 Query: 447 PQGNDDPKSQDERESDGGDTGSPKSQDQHNQQDSANEENDE 569 P GNDDPKSQDER+SDGGD GSP SQD N Q++ ++ +E Sbjct: 30 PHGNDDPKSQDERDSDGGDVGSPASQDDQNHQNAFSQGREE 70 >gb|EOY27825.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508780570|gb|EOY27826.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508780571|gb|EOY27827.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 331 Score = 61.6 bits (148), Expect = 1e-07 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = +3 Query: 447 PQGNDDPKSQDERESDGGDTGSPKSQDQHNQQDSANEENDE 569 P GNDDPKSQDER+SDGGD GSP SQD N Q++ ++ +E Sbjct: 30 PHGNDDPKSQDERDSDGGDVGSPASQDDQNHQNAFSQGREE 70