BLASTX nr result
ID: Jatropha_contig00040888
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00040888 (698 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519720.1| conserved hypothetical protein [Ricinus comm... 57 7e-06 >ref|XP_002519720.1| conserved hypothetical protein [Ricinus communis] gi|223541137|gb|EEF42693.1| conserved hypothetical protein [Ricinus communis] Length = 71 Score = 56.6 bits (135), Expect = 7e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +3 Query: 216 NLVIEE*SNMPWASSFVNYSMNCIRLVVFFWVIL 317 +L IE+ SNMPWASSFVNYS NC+RLVVFF VIL Sbjct: 15 HLGIEKDSNMPWASSFVNYSRNCVRLVVFFRVIL 48