BLASTX nr result
ID: Jatropha_contig00040862
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00040862 (335 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESR47116.1| hypothetical protein CICLE_v10002139mg [Citrus cl... 56 4e-06 gb|ESR47115.1| hypothetical protein CICLE_v10002139mg [Citrus cl... 56 4e-06 >gb|ESR47116.1| hypothetical protein CICLE_v10002139mg [Citrus clementina] Length = 215 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/45 (57%), Positives = 30/45 (66%), Gaps = 5/45 (11%) Frame = +2 Query: 182 QQLDHTKESKEPEDN-----QKNPHPSDYAPYPKLDPNDVAPPAQ 301 QQ DH E+K + Q+ PH SDYAPYPK+DPNDVAPP Q Sbjct: 4 QQADHQIETKASSETHHMQQQQEPHSSDYAPYPKIDPNDVAPPPQ 48 >gb|ESR47115.1| hypothetical protein CICLE_v10002139mg [Citrus clementina] Length = 273 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/45 (57%), Positives = 30/45 (66%), Gaps = 5/45 (11%) Frame = +2 Query: 182 QQLDHTKESKEPEDN-----QKNPHPSDYAPYPKLDPNDVAPPAQ 301 QQ DH E+K + Q+ PH SDYAPYPK+DPNDVAPP Q Sbjct: 4 QQADHQIETKASSETHHMQQQQEPHSSDYAPYPKIDPNDVAPPPQ 48