BLASTX nr result
ID: Jatropha_contig00040777
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00040777 (385 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535407.1| conserved hypothetical protein [Ricinus comm... 100 2e-19 >ref|XP_002535407.1| conserved hypothetical protein [Ricinus communis] gi|223523200|gb|EEF26976.1| conserved hypothetical protein [Ricinus communis] Length = 337 Score = 100 bits (248), Expect = 2e-19 Identities = 60/102 (58%), Positives = 71/102 (69%), Gaps = 6/102 (5%) Frame = +1 Query: 97 MRKRPSCGSEKKFFVTEKATDLIACTSRVPNHLAKHK---TNQIDGNGSACPKTKQSRIE 267 MRK+ G+EKK F T+K TD I CT + PN + K +NQID SA KTK+SR E Sbjct: 1 MRKQSFSGNEKKVFNTDKTTDNIDCTCQAPNLHREQKNIVSNQIDQ--SAGHKTKKSRRE 58 Query: 268 VKAMDQCPD---LISQLPEHIIHHILSFLHCKKDAARTNILS 384 +KAMD+ D LISQLP H+IHHILS L CKKDAART+ILS Sbjct: 59 LKAMDRRSDSIDLISQLPNHVIHHILSLLRCKKDAARTSILS 100