BLASTX nr result
ID: Jatropha_contig00040746
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00040746 (693 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513668.1| ribosomal protein S9, putative [Ricinus comm... 82 1e-13 >ref|XP_002513668.1| ribosomal protein S9, putative [Ricinus communis] gi|223547576|gb|EEF49071.1| ribosomal protein S9, putative [Ricinus communis] Length = 398 Score = 82.4 bits (202), Expect = 1e-13 Identities = 50/114 (43%), Positives = 73/114 (64%), Gaps = 5/114 (4%) Frame = +2 Query: 365 FSSDSLQSGSANDLVGITDSPPAEE--DSWLKEND--SNDDQDIFEADDKEYGKRNGGDG 532 F++DS + L GITDSP + +SWL+E + SND +DIF+ +KE GG+ Sbjct: 72 FAADSKEGS----LAGITDSPVHNQLQESWLEEEEGGSNDSKDIFQGIEKESA---GGED 124 Query: 533 NNEWLTSEGYEVGNLDEKEEEKDNVFDIGEI-VSHASETGSETLVHVKSGDSEE 691 NNEWL SE Y++ NLD+ E++KD+VFDI EI +SE +E+ +V+ +EE Sbjct: 125 NNEWLQSEEYKMWNLDDAEDQKDHVFDIEEINADTSSEFTTESSANVEKEKTEE 178