BLASTX nr result
ID: Jatropha_contig00040719
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00040719 (189 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516976.1| conserved hypothetical protein [Ricinus comm... 71 2e-10 ref|XP_002326280.1| predicted protein [Populus trichocarpa] gi|5... 70 4e-10 ref|XP_006353559.1| PREDICTED: mediator of RNA polymerase II tra... 69 5e-10 ref|XP_004251686.1| PREDICTED: mediator of RNA polymerase II tra... 68 1e-09 ref|XP_004141069.1| PREDICTED: mediator of RNA polymerase II tra... 68 1e-09 gb|EMJ03746.1| hypothetical protein PRUPE_ppa011158mg [Prunus pe... 67 2e-09 emb|CBI27822.3| unnamed protein product [Vitis vinifera] 66 5e-09 ref|XP_002279553.1| PREDICTED: putative mediator of RNA polymera... 66 5e-09 ref|XP_004240333.1| PREDICTED: mediator of RNA polymerase II tra... 65 7e-09 gb|EOY30294.1| TATA-binding related factor (TRF) of subunit 20 o... 65 9e-09 gb|ERN11228.1| hypothetical protein AMTR_s00024p00226210 [Ambore... 65 1e-08 gb|ESR41864.1| hypothetical protein CICLE_v10012695mg [Citrus cl... 64 2e-08 ref|XP_002879109.1| hypothetical protein ARALYDRAFT_481687 [Arab... 64 2e-08 ref|XP_006293516.1| hypothetical protein CARUB_v10024033mg [Caps... 64 3e-08 gb|EPS64302.1| hypothetical protein M569_10471 [Genlisea aurea] 62 6e-08 ref|NP_180390.2| mediator of RNA polymerase II transcription sub... 62 6e-08 ref|XP_006295763.1| hypothetical protein CARUB_v10024884mg [Caps... 62 8e-08 ref|XP_004248866.1| PREDICTED: mediator of RNA polymerase II tra... 61 1e-07 emb|CAN67376.1| hypothetical protein VITISV_017913 [Vitis vinifera] 61 1e-07 gb|ESQ51299.1| hypothetical protein EUTSA_v10017586mg [Eutrema s... 60 3e-07 >ref|XP_002516976.1| conserved hypothetical protein [Ricinus communis] gi|223544064|gb|EEF45590.1| conserved hypothetical protein [Ricinus communis] Length = 221 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 93 MPVKWVLHWQPNAGTTVNTQILNEVSQCVESI 188 MP+KWVLHWQPNAGTTVNTQILNEVSQCVESI Sbjct: 1 MPLKWVLHWQPNAGTTVNTQILNEVSQCVESI 32 >ref|XP_002326280.1| predicted protein [Populus trichocarpa] gi|550336349|gb|ERP59438.1| hypothetical protein POPTR_0006s14580g [Populus trichocarpa] Length = 221 Score = 69.7 bits (169), Expect = 4e-10 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +3 Query: 93 MPVKWVLHWQPNAGTTVNTQILNEVSQCVESI 188 MP+KWVLHWQPNAGTTVNTQILNEV+QCVESI Sbjct: 1 MPLKWVLHWQPNAGTTVNTQILNEVTQCVESI 32 >ref|XP_006353559.1| PREDICTED: mediator of RNA polymerase II transcription subunit 20a-like [Solanum tuberosum] Length = 223 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 93 MPVKWVLHWQPNAGTTVNTQILNEVSQCVESI 188 MP+KWVLHWQPNAGTTVNTQIL EVSQCVESI Sbjct: 1 MPIKWVLHWQPNAGTTVNTQILTEVSQCVESI 32 >ref|XP_004251686.1| PREDICTED: mediator of RNA polymerase II transcription subunit 20a-like [Solanum lycopersicum] Length = 223 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 93 MPVKWVLHWQPNAGTTVNTQILNEVSQCVESI 188 MP+KWVLHWQPNAGTTVN+QIL EVSQCVESI Sbjct: 1 MPIKWVLHWQPNAGTTVNSQILTEVSQCVESI 32 >ref|XP_004141069.1| PREDICTED: mediator of RNA polymerase II transcription subunit 20a-like [Cucumis sativus] gi|449488087|ref|XP_004157936.1| PREDICTED: mediator of RNA polymerase II transcription subunit 20a-like [Cucumis sativus] Length = 223 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = +3 Query: 93 MPVKWVLHWQPNAGTTVNTQILNEVSQCVESI 188 MP+KWVLHWQPNAG+TVN+QILNEVSQCVESI Sbjct: 1 MPLKWVLHWQPNAGSTVNSQILNEVSQCVESI 32 >gb|EMJ03746.1| hypothetical protein PRUPE_ppa011158mg [Prunus persica] Length = 221 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = +3 Query: 93 MPVKWVLHWQPNAGTTVNTQILNEVSQCVESI 188 MP+KWVLHWQPNAGTTVN+QI+NEV+QCVESI Sbjct: 1 MPLKWVLHWQPNAGTTVNSQIINEVTQCVESI 32 >emb|CBI27822.3| unnamed protein product [Vitis vinifera] Length = 223 Score = 65.9 bits (159), Expect = 5e-09 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +3 Query: 93 MPVKWVLHWQPNAGTTVNTQILNEVSQCVESI 188 MP+KWV HWQPNAGTTVN+Q++NEVSQCVESI Sbjct: 1 MPLKWVFHWQPNAGTTVNSQMINEVSQCVESI 32 >ref|XP_002279553.1| PREDICTED: putative mediator of RNA polymerase II transcription subunit 20-like [Vitis vinifera] Length = 222 Score = 65.9 bits (159), Expect = 5e-09 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +3 Query: 93 MPVKWVLHWQPNAGTTVNTQILNEVSQCVESI 188 MP+KWV HWQPNAGTTVN+Q++NEVSQCVESI Sbjct: 1 MPLKWVFHWQPNAGTTVNSQMINEVSQCVESI 32 >ref|XP_004240333.1| PREDICTED: mediator of RNA polymerase II transcription subunit 20a-like [Solanum lycopersicum] Length = 222 Score = 65.5 bits (158), Expect = 7e-09 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +3 Query: 93 MPVKWVLHWQPNAGTTVNTQILNEVSQCVESI 188 MP+KW+LHW+PNAGT+VNTQIL E+SQCVESI Sbjct: 1 MPIKWILHWRPNAGTSVNTQILTEISQCVESI 32 >gb|EOY30294.1| TATA-binding related factor (TRF) of subunit 20 of Mediator complex [Theobroma cacao] Length = 222 Score = 65.1 bits (157), Expect = 9e-09 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = +3 Query: 93 MPVKWVLHWQPNAGTTVNTQILNEVSQCVESI 188 MP+KWVL+WQPNAG+TVN+QILNEVSQCVESI Sbjct: 1 MPLKWVLNWQPNAGSTVNSQILNEVSQCVESI 32 >gb|ERN11228.1| hypothetical protein AMTR_s00024p00226210 [Amborella trichopoda] Length = 216 Score = 64.7 bits (156), Expect = 1e-08 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +3 Query: 93 MPVKWVLHWQPNAGTTVNTQILNEVSQCVESI 188 MPVKW+LHWQPNAGTT+N+Q+L EVSQCVE I Sbjct: 1 MPVKWLLHWQPNAGTTINSQVLTEVSQCVEGI 32 >gb|ESR41864.1| hypothetical protein CICLE_v10012695mg [Citrus clementina] Length = 222 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +3 Query: 93 MPVKWVLHWQPNAGTTVNTQILNEVSQCVESI 188 M +KWVLHWQPN GT+VN+QILNEVSQCVESI Sbjct: 1 MTIKWVLHWQPNVGTSVNSQILNEVSQCVESI 32 >ref|XP_002879109.1| hypothetical protein ARALYDRAFT_481687 [Arabidopsis lyrata subsp. lyrata] gi|297324948|gb|EFH55368.1| hypothetical protein ARALYDRAFT_481687 [Arabidopsis lyrata subsp. lyrata] Length = 219 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +3 Query: 93 MPVKWVLHWQPNAGTTVNTQILNEVSQCVESI 188 MPVKWVLHWQPN G+TV++QILNEV+QCVESI Sbjct: 1 MPVKWVLHWQPNQGSTVSSQILNEVTQCVESI 32 >ref|XP_006293516.1| hypothetical protein CARUB_v10024033mg [Capsella rubella] gi|565471430|ref|XP_006293517.1| hypothetical protein CARUB_v10024033mg [Capsella rubella] gi|482562224|gb|EOA26414.1| hypothetical protein CARUB_v10024033mg [Capsella rubella] gi|482562225|gb|EOA26415.1| hypothetical protein CARUB_v10024033mg [Capsella rubella] Length = 219 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +3 Query: 93 MPVKWVLHWQPNAGTTVNTQILNEVSQCVESI 188 MPVKWVLHWQPN G+TV++QILNE SQCVESI Sbjct: 1 MPVKWVLHWQPNQGSTVSSQILNEASQCVESI 32 >gb|EPS64302.1| hypothetical protein M569_10471 [Genlisea aurea] Length = 359 Score = 62.4 bits (150), Expect = 6e-08 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +3 Query: 93 MPVKWVLHWQPNAGTTVNTQILNEVSQCVES 185 MP+KW+LHWQPN G TVNTQIL+EVSQC ES Sbjct: 1 MPIKWILHWQPNPGATVNTQILSEVSQCAES 31 >ref|NP_180390.2| mediator of RNA polymerase II transcription subunit 20a [Arabidopsis thaliana] gi|75127115|sp|Q6NPF4.1|MD20A_ARATH RecName: Full=Mediator of RNA polymerase II transcription subunit 20a gi|38454106|gb|AAR20747.1| At2g28230 [Arabidopsis thaliana] gi|38604010|gb|AAR24748.1| At2g28230 [Arabidopsis thaliana] gi|330252999|gb|AEC08093.1| mediator of RNA polymerase II transcription subunit 20a [Arabidopsis thaliana] Length = 219 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +3 Query: 93 MPVKWVLHWQPNAGTTVNTQILNEVSQCVESI 188 MPVKWVLHWQPN G+TV++QILNE +QCVESI Sbjct: 1 MPVKWVLHWQPNQGSTVSSQILNEATQCVESI 32 >ref|XP_006295763.1| hypothetical protein CARUB_v10024884mg [Capsella rubella] gi|482564471|gb|EOA28661.1| hypothetical protein CARUB_v10024884mg [Capsella rubella] Length = 219 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +3 Query: 93 MPVKWVLHWQPNAGTTVNTQILNEVSQCVESI 188 MP+KWVLHWQPN G+TV++QILNE S+CVESI Sbjct: 1 MPIKWVLHWQPNQGSTVSSQILNEASECVESI 32 >ref|XP_004248866.1| PREDICTED: mediator of RNA polymerase II transcription subunit 20a-like [Solanum lycopersicum] Length = 215 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +3 Query: 93 MPVKWVLHWQPNAGTTVNTQILNEVSQCVESI 188 MPVKWVL WQPNAGTT+N+QIL EVS+CVESI Sbjct: 1 MPVKWVLCWQPNAGTTINSQILIEVSECVESI 32 >emb|CAN67376.1| hypothetical protein VITISV_017913 [Vitis vinifera] Length = 242 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +3 Query: 60 TSAIFQFSQQTMPVKWVLHWQPNAGTTVNTQILNEVSQCVESI 188 T + + +Q + WV HWQPNAGTTVN+Q++NEVSQCVESI Sbjct: 9 TQLLSRLAQLXCRLSWVFHWQPNAGTTVNSQMINEVSQCVESI 51 >gb|ESQ51299.1| hypothetical protein EUTSA_v10017586mg [Eutrema salsugineum] Length = 207 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +3 Query: 93 MPVKWVLHWQPNAGTTVNTQILNEVSQCVESI 188 MPVKWVL+WQPN G+TV++QILNE +QCVESI Sbjct: 1 MPVKWVLYWQPNQGSTVSSQILNEATQCVESI 32