BLASTX nr result
ID: Jatropha_contig00040712
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00040712 (556 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520177.1| DNA binding protein, putative [Ricinus commu... 59 1e-06 >ref|XP_002520177.1| DNA binding protein, putative [Ricinus communis] gi|223540669|gb|EEF42232.1| DNA binding protein, putative [Ricinus communis] Length = 265 Score = 58.5 bits (140), Expect = 1e-06 Identities = 28/54 (51%), Positives = 32/54 (59%) Frame = +3 Query: 393 MDPPAMMNNGSYNLAEIWQFPVNANXXXXXXXXXXXXXXDSNGDILRNDPMNLE 554 MDPP +MN+GSYNLAEIW FPVN N DSN D+ ND M L+ Sbjct: 1 MDPPVLMNDGSYNLAEIWPFPVNGNGRGQFGQNLGAQFLDSNRDVSGNDLMILD 54