BLASTX nr result
ID: Jatropha_contig00040704
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00040704 (532 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGB05603.1| squalene synthase [Camellia oleifera] 57 2e-06 >gb|AGB05603.1| squalene synthase [Camellia oleifera] Length = 414 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/50 (58%), Positives = 32/50 (64%) Frame = +1 Query: 28 IQKACQESGLLNKRKSYINRSKPRYNSAXXXXXXXXXXXXXXYLSANRPS 177 IQK C+ESG LNKRKSYI +S+PRYNS YLSANRPS Sbjct: 363 IQKICRESGTLNKRKSYIVKSEPRYNSTLVFVLFIILAILFAYLSANRPS 412