BLASTX nr result
ID: Jatropha_contig00040288
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00040288 (556 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526910.1| amino acid transporter, putative [Ricinus co... 63 4e-08 >ref|XP_002526910.1| amino acid transporter, putative [Ricinus communis] gi|223533729|gb|EEF35463.1| amino acid transporter, putative [Ricinus communis] Length = 520 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +1 Query: 457 TFSSQQWPRSFRETVDSYSISMSPNFGFLGRGQ 555 TFSSQQWP+SFRET DSY+ISMSPNFGFLG Q Sbjct: 52 TFSSQQWPQSFRETTDSYTISMSPNFGFLGLAQ 84