BLASTX nr result
ID: Jatropha_contig00040075
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00040075 (606 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519315.1| pentatricopeptide repeat-containing protein,... 60 4e-07 >ref|XP_002519315.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223541630|gb|EEF43179.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 491 Score = 60.1 bits (144), Expect = 4e-07 Identities = 31/66 (46%), Positives = 42/66 (63%) Frame = +2 Query: 401 LVVCSYSATSPSSYEKKHWKKGEFPGITETFAPRKQPIKNTSPSSSEKKHWKKGEFPGIT 580 LV+C+Y+ TS S +KKHWK+GEFPG TET PR+ PIKN ++K+ K +T Sbjct: 41 LVLCAYAPTSTSP-KKKHWKQGEFPGFTETSPPRRTPIKNIK-KKLDRKNKAKAWVNTVT 98 Query: 581 ETFAPR 598 E + R Sbjct: 99 EALSDR 104