BLASTX nr result
ID: Jatropha_contig00039894
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00039894 (598 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEE96147.2| hAT dimerization domain-containing family protein... 63 5e-08 >gb|EEE96147.2| hAT dimerization domain-containing family protein [Populus trichocarpa] Length = 696 Score = 63.2 bits (152), Expect = 5e-08 Identities = 33/44 (75%), Positives = 41/44 (93%), Gaps = 2/44 (4%) Frame = +1 Query: 472 MNFGVTGTVSGRAA-NQMDWTVNNAFKTYKDME-PKAVMDMAII 597 M+FG TG+VSGRAA NQM+WTVNNAFKTYKDM+ PK++MD+A+I Sbjct: 1 MDFG-TGSVSGRAAANQMEWTVNNAFKTYKDMDHPKSMMDVALI 43