BLASTX nr result
ID: Jatropha_contig00039871
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00039871 (609 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512923.1| hypothetical protein RCOM_1447500 [Ricinus c... 70 6e-10 >ref|XP_002512923.1| hypothetical protein RCOM_1447500 [Ricinus communis] gi|223547934|gb|EEF49426.1| hypothetical protein RCOM_1447500 [Ricinus communis] Length = 718 Score = 69.7 bits (169), Expect = 6e-10 Identities = 31/60 (51%), Positives = 41/60 (68%) Frame = +3 Query: 414 MSDQAAQSDNGKDEIPEKYLQSQQSVWMSHWTHTSYRSANVTHNKLLLNCESGHNSQRIK 593 MSD+ QSD+ KD +P+K ++ QS WMSHWTH+ YR + N+L L ESG N+QR K Sbjct: 1 MSDRIVQSDHDKDNVPDKSMKPFQSAWMSHWTHSRYRPIDDAQNQLSLPSESGKNTQRCK 60