BLASTX nr result
ID: Jatropha_contig00039842
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00039842 (614 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526120.1| alpha-amylase, putative [Ricinus communis] g... 59 8e-07 >ref|XP_002526120.1| alpha-amylase, putative [Ricinus communis] gi|223534617|gb|EEF36314.1| alpha-amylase, putative [Ricinus communis] Length = 972 Score = 59.3 bits (142), Expect = 8e-07 Identities = 34/73 (46%), Positives = 43/73 (58%) Frame = +2 Query: 278 MEAIFSSNASSGILHSYHCNSLASSDKNVSNLGVLLQNPLIFPTSPISTRRVLYNGDRHC 457 M I A SGI SYH AS DKNV + +L +PLIFP+S RR+ YNG HC Sbjct: 1 MGGILLPGAVSGIPPSYHYFCSASLDKNVPHSSIL-HHPLIFPSSYTWKRRLFYNGSWHC 59 Query: 458 RSRTIALARRDVS 496 +SRT+ L+ + S Sbjct: 60 KSRTVVLSSMEES 72